KEGG   Burkholderia pseudomallei K96243: BPSL3110
Entry
BPSL3110          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSL3110
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSL3110
SSDB
Motif
Pfam: T6SS_VasE DUF5655
Other DBs
NCBI-GeneID: 3094306
NCBI-ProteinID: YP_109705
UniProt: Q63QB3
Position
1:3715048..3716394
AA seq 448 aa
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRFDRDALGSNVL
RASELSLVFPDGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADDRD
AGFVSRFVSEQASVADHFTDAAEADITFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSG
FEIDDGFVPPCLAIEASPILHQRLRQLIDALQAKVNALYGFHREPTKNIIEFRSGDIASF
WLLHTASAAFAALAHLHQHSALHPERLFQELLRLAGQLMTFSKGYVLADLPAYRHDDPGP
GFARLDSILRELLETVISTRYFAITLEEVRPSFHVGRLDSGKIDDKTAFYLAVSADMPSV
ELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQAQSAMIYAPSGINDLKFELIAVTS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagttattcggccaaggtgctctggggagaaggcctctttctgaggccgcagcacttt
cagcggcaggacgcgtatcacgaagcgcgcctgttcgaatcgatccaggcgatccagccg
tacaactggggcgtgcgttcggtgcggttcgatcgcgacgcgctcggcagcaacgtgctg
cgcgcgagcgaactgtcgctcgtgtttccggacggcgcgctctactccgcgccgcaagcc
gacgaactgccgccgcccatcgcgctcgacacgctgcccgaaggcatcaacgaattcacg
ttctacctcgcgctgcacccgctgcgcgagaccggctcgaactacgcggacgaccgcgac
gccggcttcgtgtcgcgcttcgtcagcgaacaggcgagcgttgccgatcacttcaccgac
gccgcggaagcggacatcacgttcctgaagacgaacgtgaagctgatcgcgcacagcgag
ccgcgcgaccagttgctgtcgatcccgctcgtacgcgtgcgccgcaccgcgacgtccggc
ttcgagatcgacgacggcttcgtgccgccgtgcctcgcgatcgaggcgtcgccgatcctg
caccagcgcctgcgccagttgatcgacgcgctgcaggcgaaggtgaatgcactgtacggt
ttccatcgcgagccgacgaagaacatcatcgagttccgctcgggcgacatcgcatcgttc
tggctgctgcacacggcgagcgccgcgttcgccgcgctcgcgcacctgcaccagcattcg
gccttgcatccggagcggctgttccaggaactactgcgcctcgcgggccagttgatgacg
ttctcgaagggctacgtgctcgccgatctgcccgcgtaccggcatgacgatccgggcccg
ggcttcgcgcggctcgattcgatcctgcgcgagctgctcgagaccgtgatctcgacgcgc
tacttcgcgatcacgctcgaggaagtgcggccgtcgttccatgtcgggcggctcgactcg
ggcaagatcgacgacaagaccgcgttctatctcgcggtgtcggccgacatgccgtcggtc
gaactcgtcgatgcggtgcccgcgcgcttcaaggtgggcgcgccggacgacgtcgacaag
ctcgtgctctccgcgatgccgggcgtgcgcctcgcgtacacgccgcaggtgccgcccgcg
attcccgtgcgcccgggcgcatgctatttcgcactcgatgcgcgcagcccgctctatgag
cggatgctgcaggcccagtcggcgatgatctatgcgccgtccggaatcaacgatctcaaa
ttcgaactgatcgccgtcacgtcatga

DBGET integrated database retrieval system