KEGG   Burkholderia pseudomallei K96243: BPSL3208Help
Entry
BPSL3208          CDS       T00203                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bps00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BPSL3208 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bps03011]
    BPSL3208 (rplV)
Ribosome [BR:bps03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BPSL3208 (rplV)
  Bacteria
    BPSL3208 (rplV)
  Archaea
    BPSL3208 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-GeneID: 3091434
NCBI-ProteinID: YP_109802
UniProt: Q63Q16
Position
1:complement(3805747..3806076)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaagacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggctggcatcgtgaagaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgacatcgacgagctcaagatcaagagcatctacgtcgacaaggctgca
tcgctcaagcgtttcaccgcgcgcgcaaagggccgcggcaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system