KEGG   Burkholderia pseudomallei K96243: BPSS0078Help
Entry
BPSS0078          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD T6SS_Vgr DUF2345 DUF3540
Motif
Other DBs
NCBI-GeneID: 3096879
NCBI-ProteinID: YP_110101
UniProt: Q63P68
Position
2:88921..91692
Genome map
AA seq 923 aa AA seqDB search
MNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCVSTR
RDLPPGVLLGIPVSIRLITDRGQPHTVNAIISDVQIGQSDGELCVYQLTVCDALSLMDKR
TNSRVFRKRSVIDVLATLFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAH
FVRRLLRREGITVFAKAGPAKGERPLQGDAPVHTLVCCDDPMSLPQAPAGTVRLHPRDGG
AAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESSVASSLDQGEAGNDLAKLLTDIAI
DIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITLTGDPQWDRQRADK
RQFVITSIDHDIWNNLPKGLNERVHALFAASRNLAYAPRALPSALANDADTRYENTFACV
RRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHAQGA
GTNGNAGDSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGAHPP
ATFSHAGGLPGNRYLSGIKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQ
PRENGHGNDRGEGVELRTDAAAALRAAQGMLLTTYARTQASGGQLDRDELIRLLGECAEL
FKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPGTDGADAPSDGAARALMAFGAQAGSVN
VTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQAVAGEGPMLLQA
QAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDIKLLSASH
QWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEGKTDAS
GLTDLVKDDAMRIAKIDYLKPKL
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgatacgctacgcaattttgcgtcgggggcggtcgactggaataaacgtccggtc
gcgttgcactttggcgccgcgcaggccgcgctgggccacctcctcgcgctgcagcacgcc
agtgttcaggaagggctgatgaccgggatccacggccgattgacctgcgtgtcgacccgc
cgcgaccttccgcccggcgtgttgctcggcattccggtttcgatccggctgatcaccgac
cgcggacagccgcacacggtgaacgcgatcatcagcgacgtccagatcggccaaagcgac
ggcgagctctgtgtgtaccagctgacggtctgcgacgcgctgtcgctgatggacaagcgt
accaattcgcgggtcttccgaaagcgcagcgtcatcgatgtgctcgccacgctgttcaac
gaatggcagcagcgcagcccggccctcgcgcgcgcgttcgaattcgatctgtccggcttg
cgcgccgatcgctatccgccccgcgagctgacccggcaggtcaacgaatcggatgcgcat
ttcgtgcgccgtctgctgcgccgcgaagggatcaccgtgttcgcgaaggcggggccggcg
aagggcgaacggccgttgcagggcgacgcgcccgtgcacacgctcgtgtgctgtgacgat
ccgatgtcgttgccgcaagcgccggccggcacggtccgcttgcatccgcgcgacggcggc
gccgcgcagcgcgacacggtcacgctgttcgcgctgcgtcggcaattggcgcccggcaag
gccggccgcccgtcgtgggactacaagaaggcgcggatcgacgaatcgagcgtcgcttcg
agcctcgatcagggcgaggcgggcaacgatctggcgaagctgctgaccgacatcgcgatc
gacattgcgcacgcgggcgattcatggcgcgatcacgagcggctcacccgcgcgcgcatg
ctcgcgcacgagttcgaagccgagcgccatgacggcgtcagcagcgtgcgggatctcgcc
gtgggcacatggatcacgctgacgggcgatccgcaatgggacaggcaacgcgccgacaag
cgtcagttcgtgatcacgtcgatcgatcacgacatctggaacaacctgccgaaggggctc
aacgagcgcgtgcacgcgctgttcgccgcgagccgcaatctcgcgtacgcgccccgcgcg
ctgccgtccgcgctggcgaacgacgcggatacccgctacgagaacacgttcgcgtgcgtg
cgccgcggcgtgccgcttgcgcccgcgtacgatccgcaagccgatttgccgcccgcgcat
ctgctcacgggcacgattgtcggcgcggagggcgaagaagtgttctgcgacgaagacggc
cgggtgcgcgtgcgggtgcacggcctcgatccggcggatcacgcgcacgcgcagggcgcg
ggcaccaacggcaacgcgggcgacagcgcgccgatccgcgtggcgtcgagcctcgccggc
gcccatttcggcgcatcgttcctgccgcgagtcggcatggaagtcctcctcggatgtctc
ggcggcgatccggaccggctggtgatcatcggcgtgctcggtaacggcgcgcatccgccg
gcgacgttcagccacgcgggcgggctgccgggcaaccgctacctgtcgggcatcaagacg
aaggagattcgtgggcaacggtacaaccagctgcgtctcgacgacacgccgaaccagatc
agcgcgcaactggcgagcgagcacgcgcattcgcagctcaatctcggatatctgacgcaa
ccgcgcgagaacggccacgggaacgaccgcggcgagggcgtggagttgcgtaccgacgcg
gcggcggcgctgcgggcggcgcaaggcatgctgctgacgacctatgcgcgcacgcaggcg
agcggcgggcaactggaccgtgacgagctgattcggttgctcggcgaatgcgcggagctg
ttcaaggcgctgggcgactacgcggggcagcacggcgggcaggccgcggatacggccggc
cagcacgcggtggccgccgcgttcaagcgctgggcgccgggcacggacggcgccgatgcg
ccgtccgacggcgcagcgcgcgcgctgatggcgttcggcgcgcaggccggttcggtgaac
gtcacgccgaagacgcatgtgacgtatgccggcgagaacatcgatcaggtcgcgcagcag
cacctgcaactgatgagcggccagcggctgaacgcgacggccgggcagggcatgcagctc
ttcgcgcggggcgcgggggtgcaggccgtggcgggcgaagggccgatgctgctgcaggcg
caagccggcacgctgacggcgaacgcgcagaagggcgtcaagatcacgacgaacgagcac
gaggtgttcgtgagcgcgccgaagattcggctcgttgccgaggacggcagctacctcgag
ctcggcggcggcatcacgctcggcacgaacggcgacatcaagctgctgtcggcgtcgcac
cagtggggcgggccgtcgaccgcgcaggcggcgaagagcgggttcggcaatcagccgacg
gatcagcgtttcaagctgcactatccgggcgaggacggcgatttgcaggcggcggcgaac
aagcggttccggatcacgctggacgacgggcgcgtcatcgaaggcaagaccgacgcgagc
ggcctgacggatctggtcaaggacgacgcgatgcgtatcgcgaagatcgactatctgaag
ccgaagctttga

DBGET integrated database retrieval system