KEGG   Burkholderia pseudomallei K96243: BPSS0097
Entry
BPSS0097          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0097
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS0097
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-GeneID: 3096823
NCBI-ProteinID: YP_110120
UniProt: Q63P49
Position
2:117729..118268
AA seq 179 aa
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPAVGDR
KFFSIDIDNFDERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVDALS
QLLDARTQLANLQTYMDGKSGAENLVSKVLKDPALLSALAKAPKPVAEQAENRESKEKH
NT seq 540 nt   +upstreamnt  +downstreamnt
atggctatatccaatagctcacagaaatttatcgcgcgcaatcgtgcgcctcgcgttcag
atcgaatatgacgtcgagatttacggctccgaaaagaaggtcgagcttccgttcgtgatg
ggcgtgctcgcggacctgtcgggcaagccgctcgagcctctgccggcggtcggcgaccgc
aagttcttcagcatcgatatcgacaatttcgacgagcgcatgaaggcgatgaagccgcgt
gtcgcgttctcggtgccgaatactctttccggcgacggtcaattgatggtcgacatcacg
ttcgaaagcatggacgacttttctcccgcggcgatcgcgaagaaggtggatgcgttgtcg
caattgctggacgcgcgcacgcagcttgccaatctgcagacctacatggacggaaagtcg
ggcgcggagaacctcgtgagcaaggtgctcaaggaccccgcgctgctgagcgcgcttgcg
aaggcgccgaagcccgtggcggaacaggcggaaaacagggaatcgaaggaaaagcactga

DBGET integrated database retrieval system