KEGG   Burkholderia pseudomallei K96243: BPSS0099Help
Entry
BPSS0099          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPSS0099
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0099
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-GeneID: 3096775
NCBI-ProteinID: YP_110122
UniProt: Q63P47
Position
2:120001..120483
Genome map
AA seq 160 aa AA seqDB search
MSHDIFLKINGIDGEAEDATHKGEIEVLSWSWNVSQQSNMHLGSGGGAGKATIDDLQFEH
YIDRASPNLVQYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDVLVTQVSPTGVAQDESR
PRELVRLSFSRLKQEYVVQNPQGGSGGAITATFDIKKNAA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgacattttcctcaagatcaacggtatcgatggcgaggcggaagacgcaacc
cacaagggcgaaatcgaggtcttgagctggtcgtggaacgtcagtcagcaatcgaacatg
cacctgggttcggggggcggcgcgggcaaggcgacgatcgatgatctgcagttcgaacat
tacatcgatcgcgcgagcccgaatctcgttcaatactgcttgctcggcaagcatatcgac
gaagcccggctcgtggtgcgtaaggcgggcggcagcccgctcgaatacatcaagctcacg
atgagcgatgtgctcgttacgcaggtgagcccgacaggcgtggctcaggacgaatcgcgc
ccgcgtgagctcgttcggctgtcgttctcgcgcctgaagcaagagtatgtcgtccagaac
ccgcagggcggcagcggcggcgcaatcaccgcgactttcgacatcaagaagaacgcggcg
taa

DBGET integrated database retrieval system