KEGG   Burkholderia pseudomallei K96243: BPSS0105Help
Entry
BPSS0105          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPSS0105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0105
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD
Motif
Other DBs
NCBI-GeneID: 3096600
NCBI-ProteinID: YP_110128
UniProt: Q63P41
Position
2:128553..131252
Genome map
AA seq 899 aa AA seqDB search
MFLGKWKREDCMPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTY
ELLLRTPDDFHVPLATSANLDLKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREISGLVVK
AGFLRCEGRYNVYRIELRPWLWLATLTSDYKIFQDKSVVEIIDTVLHDYPYPVEKRLDID
KYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFFEHSDNKHRLVLCDHIGGHR
KAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLASLVTSNHQPR
ETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKH
KHDGANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGP
QSAIVVGPPGHEVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRI
GQEVIVGFMNGDPDRPLILGSLYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFE
DKLGAEEFHMQAEKDMNRLTKNDESHTVGANFSIGVGLTHTRAVGAMFSSIVGGAASYAV
GGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVGGAYALTVGGVLSIVCGASS
ITMTACGSIKLVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGGAIPPIPLPS
FFLDITKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP
TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPMPTPTPTPTPTPTPTPTP
TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaggtaagtggaagcgagaagactgcatgccaaaccatttttcgaacggacgg
acgaatcaaagccgcacggtagtgatccgcagcggtgcgatgccgcggctgctcggtcag
cccgcgctcgagttcctgtcgctgcgcggtgaagagcacctcggaaaactctacacgtac
gaattgctcctgcgcacgccggacgattttcatgtgccgttggcaacgagcgcgaatctc
gacctgaaggcgatgatcggcacggagatgacggtctgcattcagctcgacggaatcggg
acgggcgcgcaaggcggcgttggcgcgggtgcgcgcgaaatcagcgggctcgtggtcaag
gcgggcttcctgcgctgcgaggggcgctacaacgtctatcgcatcgagctgcgcccctgg
ctgtggctcgcgactttgacgagcgactacaagatttttcaggacaagagcgtcgtcgaa
atcatcgatacggtcttgcacgattacccttacccggtcgagaagcggctcgacatcgac
aagtattcggtggcgggcgagagcgctcgaaacgagccgcgcgcgttccaggtgcaatat
ggcgaaaccgacttcgacttcgttcagcgtttgatggaggagtgggggatctactggttc
ttcgagcattcggacaacaagcatcgcctggtcttgtgcgatcacatcggcggacatcgc
aaggcgccgagcgaggcctatcacgagatcgcgcatcacccggaaggcgggaagatcgac
atcgagtacatcaactatttctcgacggacgaagcgctgcggcccggccgcgtcgtgata
gacgatttcgacttcacgcgtccgctcgcgagcctcgtcacgtccaatcaccagccgcgg
gagacgaactggggggagggcgagctgttcgaatggccgggcgactataccgatagcaag
catggcgatctcatcagccgcgtgcgcatggaagagcgccgcgcgaccgggtcgcgcgca
tacggtcggggcaacgtgcgcggcctcgcctgcggtcatacgttcgtgctgtcgaagcac
aagcacgacggcgcgaaccgcgagtacctcgtcatcgaatcggcgttgatgctgaccgaa
gtcgcggacgaaacgggcagcggctaccgctacgaatgcgataacgaactggtcgtgcag
ccgtcgaacgaggtgtttcgaatgccgcgcgaaacgcccaagccgacgacgagcgggcca
cagtccgcgatcgtggtcgggccgccgggccacgaggtatggaccgacgaattcggccgc
gtgaagatccgttttctgtgggatcgctacgcacgcaatgacgcaacggattcctgctgg
gtacgcgtgagccaggcgtgggccggcgtgaacttcggcggcatctacattccgcggatc
ggacaggaagtgatcgtcggattcatgaacggcgatccggaccgtccgctgattctcggc
agcctctacaacaccattacgccgccgccttgggatctgcccggcgacgcgacgaagagc
ggattcaagagcaagtcgatcacgggcgggcgcgagaactataacggcatccgcttcgag
gacaagctgggagccgaggaatttcacatgcaggcggaaaaggacatgaaccgcctgacg
aagaacgacgagtcgcatacggtcggcgcgaatttttcgatcggcgtcgggcttacccat
acgcgcgcggtgggcgccatgttcagcagcatcgtcggcggagccgccagctatgcggtg
gggggcgcggaatcgacgatgatcggcggcgcgtatgcgttgaacgtcggcggcgcgcac
gcggttgcggtgggcggcgcgtcgtccgtttccgttggcggcgcctacgcgcgcaacgtg
ggcggcgcgtatgcgctgacagtcggcggcgtgctgtcgatcgtctgcggtgcgtcttcg
atcaccatgacggcttgcggctcgatcaagctcgtcggcaagaatattcgcatcatcggc
agcgacgaagtcgtcgtgcaaggcgcgcccctgcagctgaatccgggcgattcggattgc
ggcggagggggaggcggcggcggcggcggcggcgcgattccgccgattccgttgccgtcg
ttcttcctcgatatcacgaagccgattcttccgccgccgccgccgccaccgacggaggtg
ccaccggatccgacgccgacgccaacgccgacgccgacgcccacgcccacgccgacgccc
acgccgacgccgacgccgacgccgacgccgacgcccacgccgacgcccacgccgacgccg
acgccgacgccgacgcccacgccgacgcccacgccgacgcccacgccaacgccaacgcca
acgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccgacgccgacgccg
acgccaatgccgacgccaacgccaacgccgacgccgacgcccacgcctacgcccacgccg
acgccgacgccgacgccgacgccaacgccaacgccaacgccaacgccaacgccaacgccg
acgccgacgccgacgcccacgccaacgccgacgccaacgccaacgccgacgcccacgccg
acgccgacgccaacaccaacaccaacaccaacaccaactccgactagttccgagatttaa

DBGET integrated database retrieval system