KEGG   Burkholderia pseudomallei K96243: BPSS0114
Entry
BPSS0114          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0114
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BPSS0114
SSDB
Motif
Pfam: ImpE
Other DBs
NCBI-GeneID: 3094984
NCBI-ProteinID: YP_110135
UniProt: Q63P34
Position
2:complement(141950..142804)
AA seq 284 aa
MTNRSESPQPSDPRDAMLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGA
WERALKQLQTWAGLEPQGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQ
ANAKLGAGDVAAADTLREAAFHCAPVTRGESAEMGSFAWLTDSDTRLGPIFEIAVAGGYR
WIPFEQLKSITFTPAGTLTDLVWRPVTALMLDATVLRGYAPTRYSGSENGATAIRLASET
TWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESDDAAS
NT seq 855 nt   +upstreamnt  +downstreamnt
atgacgaatcgatctgaatctccgcaaccctccgatccgcgtgacgccatgctgcgcgac
gcgctgcgcgcccagtctttcgaggaaatcaaggcgcgcacggccgaggcggtcagaaag
cggccatccgacacgcgggaacgctggctactgtttcagttgctttgcatcgacggcgcg
tgggagcgcgcgctcaaacagctgcaaacctgggccgggctcgagccgcagggcgaggcg
cgcgcgcaactgcatcgcggcctgatccgatgcgaaatgttccgggccgacgtgtttgcc
ggcaagcgaacgccggggttcatcgacgcgcagcccgcctgggtcgacacgctcctccaa
gccaatgcgaagctcggcgccggcgacgtcgcggcggcggacacgctgcgcgaagccgcg
ttccactgcgcccctgtcacccgcggggaaagcgccgaaatgggaagcttcgcatggctt
accgacagcgacacccgcctcggtccgatctttgaaatagcggttgcaggcggctatcga
tggattccgttcgaacaactgaagtccatcacgtttacgcccgccggcacgctgaccgac
ctggtctggcgaccggtcacggcactcatgctcgatgccacggttctccgcggctatgca
cccacccgctattcgggatcggagaacggcgcgaccgcgatccgcttggccagcgagacg
acctggcgcgacatcggcaccaccaacgtcgtggcgctcggacaacgaacatggaccacc
gatcagggcgactggggcatgctccagatcggcggatgccgcttcacgggcgaaagcgac
gatgcggcatcctga

DBGET integrated database retrieval system