KEGG   Burkholderia pseudomallei K96243: BPSS0170
Entry
BPSS0170          CDS       T00203                                 

Definition
(RefSeq) lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPSS0170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0170
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS0170
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-GeneID: 3096592
NCBI-ProteinID: YP_110191
UniProt: Q63NX8
Position
2:complement(228224..228736)
AA seq 170 aa
MPRMHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSV
YELKTDGAFNAADFFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGALGVVA
AYRDLPNSVWRAAYPLPPARDAAWYRFSSPKLKLTIELDTHAIRITEPGK
NT seq 513 nt   +upstreamnt  +downstreamnt
gtgcctcgaatgcatccgaccacccccgttgccgccgtcgcgctcgcgctcgcgtgcgcc
gcgtgcgcgagcggcgcggccaagcagaaggagccgctgcggctcgagctcgccgtgcgc
gccgcgcccacggtcaatccggacgatcggagccggccggctccgatcgtcgtgagcgtc
tacgagctgaagaccgacggcgcattcaacgccgccgatttcttcacgctgcagggcccg
gacaagaccgtgctcgccgacgatctgctcgcgcgcgagcgttttcaactgcgccccggc
gagcgccgcgtgatccggcgcgacgccgatccggcggcgggcgcgctcggcgtcgtcgcc
gcgtaccgcgatctgccgaactcggtgtggcgcgcggcatatccgctgccgcccgcgcgg
gacgccgcatggtatcgcttctcgtcgccgaagctgaagctgaccatcgagctcgacacg
cacgcgatcaggatcaccgaacccggaaaatga

DBGET integrated database retrieval system