KEGG   Burkholderia pseudomallei K96243: BPSS0176Help
Entry
BPSS0176          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0176
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BPSS0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE Nic96
Motif
Other DBs
NCBI-GeneID: 3096401
NCBI-ProteinID: YP_110197
UniProt: Q63NX2
Position
2:235775..236740
Genome map
AA seq 321 aa AA seqDB search
MTTPAFPAPPGARTSARPHDTLLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQWERA
VGQLQAYARFAAQHAHIAHAYRDLIRAERFRARVMAGQARPGFVFDAPPWIDDLLEALRA
QAAGARDEADRARSRALDRAPFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFS
DLAGWRLARPGVLLALVWAPCVLTLADGSVAHGFMPARYPGSELADGGGAPGASAAAHEA
DAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTSAGDAGLFELHACEFGARARA
GAVLGGAAREARGGEAADGCA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcctgccttcccggcgccgcccggcgcgcgcacgtcggcccggccgcacgat
acgctgctcgacgcgcggctcgcggctgcgcaagccgcggtgcgcgcccggcccgtcgat
gcggcgagccgttgggcgctgtttcaactgctctgcgtgacgggccagtgggaacgcgcc
gtcgggcagttgcaggcttatgcgcggttcgccgcgcagcacgcgcacatcgcgcacgcc
tatcgcgacctgattcgcgccgagcgctttcgcgcccgcgtgatggcgggccaggcgcgg
ccgggattcgtattcgatgcgccgccgtggatcgacgatctgctggaagcgttgcgcgcg
caggcggccggcgcgcgcgacgaagccgaccgcgcgcgttcgcgcgcgctcgatcgcgcg
ccgttcgtcgcggggcgcgggccggatgcgccgttcgactggatcgccgacagcgattcg
cgattcgggccggtctgcgaagtcgtgaccgccgggcatgatcgttggctgccgttttcg
gatctggccggatggcggctcgcgcgcccgggcgtgctgctcgctctggtctgggcgccg
tgcgtgctcacgcttgccgacggcagtgtcgcgcacggcttcatgccggcgcgttacccg
ggctccgaactggccgacgggggcggcgcgccgggcgcctcagcggccgcgcacgaggcc
gatgcgcacgagagcgccgcgcgcgaggccgatgcgttgcggctcggcagccggaccgca
tggcgcgacgtcggccgcaccggcgtgttcgcgctcggccgcaagacctggtcgacgagc
gcgggcgacgccggccttttcgagctgcacgcgtgtgaattcggcgcgcgcgcccgtgcg
ggcgccgtgctcggcggcgcggcgcgcgaagcgcgcggcggggaggcggccgatggatgc
gcatga

DBGET integrated database retrieval system