KEGG   Burkholderia pseudomallei K96243: BPSS0236Help
Entry
BPSS0236          CDS       T00203                                 

Gene name
ltaE
Definition
(RefSeq) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00260  Glycine, serine and threonine metabolism
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPSS0236 (ltaE)
Enzymes [BR:bps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BPSS0236 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 3097028
NCBI-ProteinID: YP_110255
UniProt: Q63NR4
Position
2:321065..322078
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSAPMLAAMTAAEVGDDVWGDDPTVARLQAVVAERAGKEAALFFPSGTQ
SNLAALMSHCERGDEYIVGQAAHTYKYEGGGAAVLGSIQPQPIENAADGTLPLEKIAAAI
KPIDDHFARSRLFTLENTIGGKVLPAGYVDEAVALARSRGLAAHLDGARVCNAAVASGRA
IAELCAPFDSVSICFSKGLGAPVGSVLVGSGALIERAHRWRKVLGGGMRQAGVLAAACLY
ALEHNVERLADDHANAERLAQGLARIEPVKVLSQATNMVFAQFPEADCAPLEAWLKERGI
LTQMLYASRFVTHCDVSRDDIDTAVAAISAYFARSRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacgcgcccgagcgcgccgatgctggccgcgatg
acggccgccgaagtgggcgacgacgtgtggggcgacgatcccaccgtcgcgcgcctgcag
gccgtggtggccgagcgcgcgggcaaggaggcggcgctgttctttccgagcggcacgcag
agcaacctcgcggcgctgatgtcgcactgcgagcgcggcgacgagtacatcgtcggccag
gccgcgcacacgtacaaatacgagggcggcggcgcggcggtgctcggcagcattcagccg
cagccgatcgagaacgccgcggacggcacgctgccgctcgagaagatcgcggccgcgatc
aagccgatcgacgatcacttcgcccgctcgcgcctgttcacgcttgagaacacgatcggc
ggcaaggtgctgccggcgggctatgtcgacgaagcggtcgcgctcgcgcgcagccgcggg
ctcgctgcgcatctcgacggcgcgcgcgtatgcaacgcggccgtcgcgtcgggccgcgcg
atcgccgagctgtgcgcgccgttcgattcggtgtcgatctgcttttcgaaggggctcggc
gcgccggtgggctcggtgctcgtcggcagcggcgcgctgatcgagcgcgcgcaccgctgg
cgcaaggtgctcggcggcggcatgcgccaggcgggcgtgctcgcggccgcgtgcctgtat
gcgctcgagcacaacgtcgagcgtctcgccgacgatcacgcgaacgccgagcgcctcgcg
cagggcctcgcgcgcatcgagccggtgaaggtgctgtcgcaggcgacgaacatggtgttc
gcgcaatttcccgaagccgattgcgcgccgctcgaagcatggctcaaggagcgcgggatt
ctcacgcagatgctgtatgcgtcgcgcttcgtcacgcactgcgacgtgtcgcgcgacgac
atcgacacggctgtcgccgcgatcagcgcgtatttcgcgcgttcgcgcgcttga

DBGET integrated database retrieval system