KEGG   Burkholderia pseudomallei K96243: BPSS0256Help
Entry
BPSS0256          CDS       T00203                                 

Gene name
rbsC
Definition
(RefSeq) ribose ABC transporter permease
  KO
K17206  putative xylitol transport system permease protein
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BPSS0256 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSS0256 (rbsC)
Transporters [BR:bps02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative xylitol transporter
    BPSS0256 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 ACT_7
Motif
Other DBs
NCBI-GeneID: 3095953
NCBI-ProteinID: YP_110275
UniProt: Q63NP4
Position
2:344068..345045
Genome map
AA seq 325 aa AA seqDB search
MNTQTLSRLDAAPRRVNVAELASRFGIPIVFVALCVVLAFASPYFLTWRNWSDILRQTSI
NGILAIGMTYVILTKGIDLSVGSVLALAGIVSGLAGAAGHGLAVSLAAGVACGAALGAIN
GVAIARLNVPPFVATLGMLSVARGVTYIANDGSPVANLPDDYLSLGIGRLGPLGMPVLIF
AGVALACWWVLRYTTYGRYLYAVGGNEKSARTSGIGVRKVVFSVYVVSGALAGLAGMILA
ARTTSALPQAGVSYELDAIAAVVIGGTSLSGGQGGVVGTLFGALLIGVINNGLNLLGVSS
YYQQIAKGLIIVLAVLIDVARKQQR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcagaccctgtcccgtctcgacgcggcgcccaggcgcgtgaacgtcgcggag
ctcgcgagccgcttcggcatcccgatcgtcttcgtcgcgctgtgcgtcgtgctcgcgttc
gcgagcccgtacttcctcacctggcgcaactggagcgacatcctgcgccagacgtcgatc
aacggcattctcgcgatcggcatgacgtacgtgatcctgaccaagggcatcgacctgtcg
gtgggctcggtgctcgcgctcgcgggcatcgtgagcggcctcgccggcgcggcggggcac
gggctcgcggtgtcgctcgcggccggcgtcgcgtgcggcgcggcgctcggcgcgatcaac
ggcgtggcgatcgcgcgcttgaacgtgccgccgttcgtcgcgacgctcggcatgctgagc
gtcgcgcgcggcgtcacgtacatcgccaacgacggcagcccggtcgcgaacctgcccgac
gattacctgtcgctcggcatcggcaggctcggcccgctcggcatgccggtgctgatcttc
gcgggcgtcgcgctcgcgtgctggtgggtgctgcgctacacgacatacggccgctatctg
tatgcggtcggcggcaacgagaagagtgcgcgcacgtcgggcatcggcgtgcgcaaggtc
gtgttctcggtgtacgtcgtctcgggcgcgctcgccggcctcgcggggatgatcctcgcc
gcgcgcacgacgtccgcgctgccgcaggcgggcgtgtcgtacgagctcgacgcgatcgcg
gccgtcgtgatcggcggcacgagcctgtcgggcgggcagggcggcgtcgtcggcacgctg
ttcggcgcgttgttgatcggcgtgatcaacaacgggctgaacctgctcggcgtgtcgtcg
tattaccagcagatcgcgaagggactcatcatcgtgctggccgtgctcatcgacgtggcc
cgcaaacagcagcgctga

DBGET integrated database retrieval system