KEGG   Burkholderia pseudomallei K96243: BPSS0260Help
Entry
BPSS0260          CDS       T00203                                 

Definition
(RefSeq) kinase
  KO
K05878  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaK [EC:2.7.1.121]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00561  Glycerolipid metabolism
bps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BPSS0260
Enzymes [BR:bps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     BPSS0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1
Motif
Other DBs
NCBI-GeneID: 3096174
NCBI-ProteinID: YP_110279
UniProt: Q63NP0
Position
2:348094..349098
Genome map
AA seq 334 aa AA seqDB search
MNRVINHPDYVVEDMLRGIVAAHPALALDADNPRVIGVAHPVPGKVGVVTGGGSGHEPAF
VGYTGPGLVDAVAIGEIFSSPTAKSFLDAFRRADRGAGVACLYGNYAGDNMNVKMAIKMA
AAQGIDVKTVVANDDVASAPREERAKRRGVAGEILMWKAGGARAAAGGDLDAVIASAKKA
IDNTRSVGIGLSACTIPANGKANFHIADGEMEVGIGHHGEHGVRVMRTVSAKDMAAMMLD
IVLPDFPLERGEEVAVLVSGLGATPLMEQYILYAEVSQRLAAAGLKIGFRLVGNLFTSLE
MMGVTLTVTRLDDELKQLFAAPCSSIGLTVGERA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtgtcatcaatcatcccgactacgtcgtcgaggacatgctgcgcgggatcgtc
gccgcgcatccggcgctcgcgctcgacgcggacaacccgcgcgtgatcggcgtcgcgcat
ccggtgccgggcaaggtcggcgtcgtcacgggcggcggctcgggccacgagccggcgttt
gtcggctacacggggccggggctcgtcgacgcggtcgcgatcggcgagatcttctcgtcg
cccaccgcgaagagctttctcgacgcattcaggcgcgccgatcgcggcgcgggcgtcgcc
tgcctgtacggcaactacgcgggcgacaacatgaacgtgaagatggcgatcaagatggcc
gccgcgcagggcatcgacgtgaagaccgtcgtcgcgaacgacgacgtcgcgtccgcgccg
cgcgaggagcgcgcgaagcgccgcggcgtcgcgggcgagatcctgatgtggaaggcgggc
ggcgcgcgggcggccgcgggcggcgatctcgacgccgtgatcgcgagcgcgaagaaggcg
atcgacaacacgcgctcggtcggcatcggcctgtccgcgtgcacgatcccggcgaacggc
aaggcgaacttccacatcgccgacggcgagatggaggttggcatcggccatcacggcgag
catggcgtgcgcgtgatgcgcacggtgagcgcgaaggacatggcggcgatgatgctcgac
atcgtgctgccggatttcccgctcgaacgcggcgaggaagtcgcggtgctggtgtcgggg
ctcggcgcgacgccgctgatggagcagtacattctgtatgccgaagtatcgcagcggctc
gcggccgccgggctgaagatcggctttcgcctcgtcggcaatctgttcacgtcgctcgag
atgatgggcgtcacgctgaccgtcacccggctcgacgacgagttgaagcaactgttcgcc
gcgccgtgcagcagcatcggcctcaccgtgggagaacgcgcatga

DBGET integrated database retrieval system