KEGG   Burkholderia pseudomallei K96243: BPSS0474Help
Entry
BPSS0474          CDS       T00203                                 

Gene name
speB
Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00330  Arginine and proline metabolism
bps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BPSS0474 (speB)
Enzymes [BR:bps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BPSS0474 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 3096391
NCBI-ProteinID: YP_110496
UniProt: Q63N23
Position
2:644571..645533
Genome map
AA seq 320 aa AA seqDB search
MNETLYGDGAIRRPSIYGSSVENTYAGVLSFMRRNYTRDLGGVDVAVCGVPLDLATTFRS
GARLGPAAVRAASVQLAELRPYPWGFDPFDDLAVIDYGDCWFDAHNPLSIKPAIVEHART
ILQSGAAMLTLGGDHYITYPLLIAHAQRHGKPLSLIHFDAHCDTWADDAPDSLNHGTMFY
KAVNEGLIDPKTSVQVGIRTWNDDYLGIHVLDAAWVHEHGPRATAERIASIVGGRPAYLT
FDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIA
AAHVACDLLCLWRQRKTGAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacgctctacggcgacggcgcgatccgccgcccttccatctacggttcctcg
gtcgaaaacacttacgcgggcgtgctgtcgttcatgcggcgcaactacacgcgcgatctc
ggcggtgtcgacgtcgccgtctgcggcgtgccgctcgatctcgcgacgacgttccgctcc
ggcgcgcgcctgggccctgcggcggtacgcgcggcgagcgtgcagcttgccgaactgcgc
ccgtacccttgggggttcgatccgttcgacgatctcgcggtgatcgactatggcgactgc
tggttcgacgcgcacaatccgctgtcgatcaagcccgcgatcgtcgagcacgcgcgcacg
atcctgcaatcgggcgcggcgatgctgacgttgggcggcgatcactacatcacgtatccg
ctgctgatcgcgcacgcacagcggcacggcaagccgctgtcgctgattcacttcgacgcg
cattgcgacacctgggccgacgacgcgcccgacagcctcaatcacggcacgatgttctac
aaggcggtcaacgaagggctgatcgatccgaagacgtcggtgcaggtcggcatccgtacg
tggaacgacgattacctcggcatccacgtgctcgacgccgcctgggtgcacgagcacggg
ccgcgcgcgacggccgagcgcatcgcgtcgatcgtcggcggccggcccgcgtatctgacg
ttcgacatcgattgcctcgatcccgcgttcgcgccgggcacgggcacgccggtcgcgggc
gggctgtcgtccgcgcaggcgctcgcgatcgtgcgcggtctcggcggcgtgaacctgatc
ggtgcggacgtcgtcgaagtcgcgcccgcgtatgaccagagcgagatcaccgcgatcgcc
gccgcgcacgtcgcgtgcgatctgctgtgcctgtggcggcagcgcaagacgggcgcgcgc
tga

DBGET integrated database retrieval system