KEGG   Burkholderia pseudomallei K96243: BPSS1493
Entry
BPSS1493          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS1493
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS1493
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-GeneID: 3097018
NCBI-ProteinID: YP_111500
UniProt: Q63K72
Position
2:complement(2036034..2037980)
AA seq 648 aa
MSERRPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASP
GASGQVDWRAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHW
DAMSPPVSRMRARRGALQWLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAE
RDDDAPTMRAVHAFAERLPVEVVEVVEVADEADVADVAEATEATEATEATEATEATEAAD
VAETAETAETAETAETAETAETAETAETAEADAHGSTGGPAAEIAIAAAEQALIDPAGRA
APSAGTDTNANADAAGQPARLDEAAGRERALADALAQLHCVATAFAQADWADARGFRLRR
VACWSSVCALPETDAENGRTRIAAPSASIVGAAKSIDGDGEPVAAVRFAEAHAQAFPLWL
DLQRIAARALARAGGDGADARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLGE
LGAPVVAADAVSPSSLPLSPRPSPPERSSPMAGEPARAPGDACGASADDAVDRACAFAAS
GQLDLALHAIQHAIDRATSAEQRLRARVRLCELARDHWPHEVPEAFARGVIEPIRRHDLL
AWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMRLST
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgagcgaacggcgcccgcccggcggcgcggcggcgcgcgcgcgcatgccgatcgatgtc
gaagcgctcgccgtgctggggcgcacggacatcgattccgccatgcccgcgggcgccgac
gtgcgcgccgacgcgaggttcgacgcgctgcacgcggagcttgcgaagctcgcgtcgccg
ggcgcgagcgggcaagtcgattggcgcgcggcgacgcatctcgccgccgaattgctgcgc
gagcgcggcaaggatttgctcgtcggctgctatctggcgggtgcgttgctgcagacgggc
ggcgcggcggggctgcgctgcggactcgaaatcgtcggcgatctcgtcgaacgtcattgg
gatgcgatgtcgccgcccgtgtcgcggatgcgggcgaggcgcggggcgctgcaatggctg
gtcgatcgcgtcgacgccatgcacgatgcaggagccgcggcatgcggcggcgcgtgctcg
gccgaactggtcgcgcaattgcgcgcggccgcgcggcgcatcgatgcgctgctcgccgag
cgcgacgacgacgcgccgacgatgcgcgcggtgcatgcgttcgcggagcgattgccggtt
gaggtggttgaggtggtggaagtggctgacgaggctgatgtggctgatgtggctgaggcg
actgaggcgactgaggcgactgaggcgactgaggcgactgaggcgactgaggcggctgat
gtggctgagacggctgagacggctgagacggctgagacggccgagacggccgagacggcc
gagacggccgagacggccgagacggccgaggccgatgcgcacggctcgacgggagggccg
gctgcggaaatcgcgattgccgccgccgaacaggctttgattgatccggccggtcgagcc
gcgccgagcgcaggcacggatacgaacgcgaacgcagacgccgccgggcaaccggcgcgg
ctcgacgaagcggccggccgcgaacgcgcgctcgccgatgcgctcgcgcaattgcattgc
gtcgcgacggcgttcgcgcaagcggactgggccgacgcgcgcggcttccggctgcgccgc
gtcgcgtgctggtcgagcgtgtgcgcgctgccggaaacggacgcggagaacggaagaacg
cggatcgccgcgccgagcgcttcgatcgtcggcgcggcgaagagcatcgacggggatggc
gagcccgtggcggcggtgcgcttcgccgaagcgcatgcgcaggcgttcccgctctggctg
gatttgcagcgcatcgccgcgcgcgcgctcgcgcgcgcggggggcgacggcgccgatgcg
cggcgcgaagtggagacggcggttcgtgcgctgcttgcgcggctgccgggcctcgacgcg
ctgacgttcgcggacggcacgccgttcgccgacgacgcgacgcgcgcatggctcggcgag
cttggcgcgcctgttgtggcggcggatgcggtgtcgccgtcgtctttgccgctttcgccg
cgaccttcgccgcctgagcgatcgtcgccgatggcgggcgaaccggcgcgcgcgccgggc
gatgcgtgcggggcgagcgccgacgatgcagtggaccgagcgtgcgcgtttgccgcgagc
ggccagctcgatctcgcgctccacgcgattcagcatgcgatcgatcgtgcgacgagcgcc
gaacagcggttgagagcacgcgtgcggttgtgcgagcttgcgcgcgaccattggccgcat
gaggttcctgaggcgttcgcgcgcggcgtgatcgaaccgattcggcggcacgatttgctc
gcatggaatccggagctggcgctcgacggcttgtcggccgcctatgcgctgctgattcgg
cgcgatcgcgaatcggcgcacgcgaggacggtgcttgacgagatcgcgagcgtcgacgcg
gcgcgggccatgcgtttgtcgacgtga

DBGET integrated database retrieval system