KEGG   Burkholderia pseudomallei K96243: BPSS1494
Entry
BPSS1494          CDS       T00203                                 

Definition
(RefSeq) two-component system response regulator
Organism
bps  Burkholderia pseudomallei K96243
SSDB
Motif
Pfam: Trans_reg_C Response_reg Tube
Other DBs
NCBI-GeneID: 3097012
NCBI-ProteinID: YP_111501
UniProt: Q63K71
Position
2:complement(2037977..2038714)
AA seq 245 aa
MTNATRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLG
LPDGDGIDVLLRWRETQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRA
LWRRAEPSTTPVRRGRHPRAYRFDGWTLNMNTRRLLTRDAQEIPLTVGEFNLLAFFLGSP
SRVVTRAQLLECTRAFDDVFDRAVDVQIWRLRKKIEKDPKHPELIRTERGVGYYFDAKEV
ETLWG
NT seq 738 nt   +upstreamnt  +downstreamnt
atgacgaatgcgacaagatcgccggcggtgctcgtcgtcgaggacgacgaaccgttgcgg
cgcgtgctttgcaattacctgtcgggccacgggatggccgtggacggcgtgggaacggcg
gcagcggccgccgaatcggtcgggcggcgcgaatacgagatggtgttgctcgatctcggc
ctgccggacggcgacggcatcgacgtgctgctgcgctggcgcgaaacgcagcgctttccg
ctcatctgtgtgacggggcgcagcgaagaggccgatcgcatcatgggcctcgaattcggc
gcggacgattacgtcgtgaagccgtactcgctgcgcgaggtgctcgcccggatgcgcgcg
ctgtggcggcgcgccgagccgtcgacgacgcccgtgcggcgcggcaggcatccgcgtgcg
taccgcttcgacggatggacgctgaacatgaacacgcgccggctgttgacgcgcgatgcg
caggaaattccgctgacggtcggcgaattcaacctgctcgcgttctttctcggctcgccg
tcgcgcgtcgtcacgcgcgcgcagttgctcgagtgcacgcgtgcgttcgacgacgtgttc
gatcgcgcggtcgacgtgcagatctggcggctgcgcaagaaaatcgagaaggatccgaag
catcccgaactgattcgaaccgagcggggcgtcggctactacttcgacgcgaaagaggtg
gagacgctatggggatga

DBGET integrated database retrieval system