KEGG   Burkholderia pseudomallei K96243: BPSS1495
Entry
BPSS1495          CDS       T00203                                 

Definition
(RefSeq) two-component system sensor kinase
Organism
bps  Burkholderia pseudomallei K96243
SSDB
Motif
Pfam: HATPase_c MASE1 HisKA HATPase_c_3
Other DBs
NCBI-GeneID: 3096752
NCBI-ProteinID: YP_111502
UniProt: Q63K70
Position
2:complement(2038711..2040555)
AA seq 614 aa
MHGNSIDAGPPARARPARITRTARAAPRRADRAFAPGGALNAAGLLLLLFYANHLLSRPG
ACTSLNHTLSAVVWPAPVLGIALLLHCRRPLAWWLGAGSLFATLLAAGSLDWVPWHVDAL
FAAVNVVEAIAGAWLARRYLIAGGGVDTLRGFAMFVLLLPLGMAAMHATLAAAILSVWMN
DREWLSEWSRAYAANALALLVLLPALLTWNARACGATWSRSRNQLPVLATFGSLCFASIW
GYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALIAMTLGGRGPYAWHHDGHGVWA
LQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDFSNVLTTIDCHA
EYASERLASGARADDSIDEIHRAVERGRDLAAQILLAARRGEPVLTRVSVDEVVDEALAA
TRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQLARAVMNLVGNAVRAARATVVVR
VGVNGGVNGGASDGASRGANDGGAPAARAFDVAIGEASMPGGVWIEVSDDGEGIDVEPLD
RIFEPFYSNRSGAPGTGLGLAIVAGAALAHRGQIAVATDRGVGSCFRFTLPAAWGTGAPG
AMDAGAPGAVQERT
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgcacggaaattccatcgatgccgggccgcccgcgcgcgcccggcccgcacgcatcacg
cgaacggcgcgcgccgcgccgcgccgcgccgatcgcgcgttcgcgccgggcggcgcgctg
aacgcggcggggctgctgctgctgctgttctacgcgaatcatctgctgtcccggcccggc
gcgtgcacgtcgctcaatcacacgctgtcggccgtcgtgtggcccgcgccggtgctcggc
atcgcgctgctgctgcactgccggcggccgctcgcatggtggctcggcgcgggttcgctg
ttcgccacgctgctcgccgcgggctcgctcgactgggtgccgtggcacgtcgacgcgctg
ttcgcggccgtcaacgtcgtcgaggcgatcgcgggcgcgtggctcgcgcggcgctatctg
atcgcgggcggcggggtggacacgctgcgcggcttcgcgatgttcgtgctgctgctgccg
ctcggcatggcggcgatgcacgcgacgctcgcggcggcgatcctgtcggtgtggatgaac
gaccgcgaatggctgagcgaatggtcgcgcgcgtatgcggcgaacgcgctcgcgctgctc
gtgctgctgccggcgctcctcacgtggaacgcgcgcgcgtgcggcgcgacgtggtcgcgc
agccgcaatcagttgccggtgctcgcgacgttcggctcgctgtgcttcgcgtcgatatgg
ggataccaggccgaggtcgcgcgcgcgctgctcgcgctgtcgctgagctgggccgcgctc
gagggcggcctcgtgctcgcgtcccagctcaacgcgctctcggcgatcgccctgatcgcg
atgacgctcggcgggcgcggcccgtatgcgtggcatcacgacggccacggcgtctgggcg
ctgcaggtcgatctgatcggcgtcgcgatcctgtcgatgtgcatcgcgatcgcgacgggc
gagcggcggcggctcgcgcggcagatcgaacgatcgcgccgtttcgagtcgctcggcttt
ttcgccggcggaatcgtgcacgatttcagcaacgtgctgacgacgatcgattgccacgcc
gaatacgcgtccgagcggctcgcgagcggcgcgcgcgcggacgattcgatcgacgagatt
catcgcgcggtcgaacgcggccgcgatctggcggcgcagatcctgctcgccgcgcgccgc
ggcgagcccgtgctgacgcgggtgagcgtcgacgaggttgtcgacgaggcgctcgccgcg
acacgcgcggccgcgtggcgcggcgtcgagatcgttcgatgcggcgatggcgcgcgcgac
ggcgcccggcgtggcgacgttcgtcacgtcgtattcgccgaccgcagccagctcgcgcgc
gcggtcatgaatctcgtcggcaatgcggtgcgcgcggcgcgcgcgacggttgtcgtgcgt
gtcggggtgaacggcggggtgaacggcggcgcgagcgatggggcgagccgcggcgcgaac
gacggcggcgcgccggccgctcgcgcattcgacgtcgcgatcggcgaagcgtcgatgccg
ggcggcgtgtggatcgaggtgagcgacgacggcgaaggcatcgacgtcgagccgctcgac
cgcatcttcgagccgttctattcgaaccgctccggcgcgccggggacggggctgggtctc
gcgatcgtcgcgggcgcggcgctcgcgcaccgcgggcagatcgccgtcgcgacggatcgg
ggcgtgggcagttgctttcggttcacgttgccggcggcatggggaacgggcgcgcccggc
gcaatggacgccggcgcgcccggcgcagtacaggagaggacatga

DBGET integrated database retrieval system