KEGG   Burkholderia pseudomallei K96243: BPSS1496
Entry
BPSS1496          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS1496
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS1496
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-GeneID: 3096753
NCBI-ProteinID: YP_111503
UniProt: Q63K69
Position
2:2040815..2041309
AA seq 164 aa
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKD
DFNDVMRAQNLQLTLSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIA
LRDALKALKSPIGNIPGFRRRIQEIVADKGARKQLLDELGLDEQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgacaacgaacggatccgtcgcgcccaaagagcgggtcaacatcgtctatcgcccggcg
acgggcgacgcgcaggcggaggtcgagctgccgctcaaggtgctcgtgctcggcgagttc
tcgacggccgccgacaagccgccgctcgaggagctctcgcccgtgaacgtcgacaaggac
gacttcaacgacgtgatgagggcgcagaacctccagctcacgctcagcgtgccgaacctg
ctggacgatcaggccggcgaggacgaccggctgtccgtcacgctcggcttcgattcggtg
cacgatttctcgcccgacgcgatcgtcgagaaagtgcccgagctcaagcagctgatcgcg
ctgcgcgacgcgctgaaagcgctgaagagcccgatcggcaacattcccggctttcgcagg
cgcatccaggagatcgtcgccgacaagggcgcgcgcaagcagttgctcgacgaactcggc
ctcgacgaacaatga

DBGET integrated database retrieval system