KEGG   Burkholderia pseudomallei K96243: BPSS1497
Entry
BPSS1497          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS1497
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS1497
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-GeneID: 3096333
NCBI-ProteinID: YP_111504
UniProt: Q63K68
Position
2:2041333..2042832
AA seq 499 aa
MEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKP
KRPIETVSQATIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVK
VQILDVGKTALFDDFEDSPDITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVK
LLQYVASTSAMAHTPFIAAAGPAFFGIDSFGKLPNVKDLASLFEGPQYAKWNAFRESEDA
RYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHFLWGNAAFAFATRLTASFADYR
WCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISERREFELAEQGFIALTMRKNS
DNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKVIQRENIGSW
KERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPH
FKYMGAFFTLSLVGKLEKR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggaaggcgaacacctgcaatccccgaagcacgacgacgcgccggacgcgacgccgccc
gagtcccccgcctcgctgctcgacgagctgatcgaggccgcgcgcgtgaagcgcgacgaa
gacgcatacccgatcacgcgccacggcatccaggcgttcgtcgcgcatctggcgaagccc
aagcgcccgatcgagaccgtgagccaggcgacgatcgacgacatgatcgccgagatcgac
cgcaagctgtgccggcagatcgacgcgatcctccatgacccggcattccagcaactcgaa
tcgacgtggcgctcgctgaagtttctcgtcgatcgaacggatttccgcgagaacgtgaag
gttcagattctcgacgtcggcaaaacggcgctgttcgacgacttcgaggattcgcccgac
atcacgaaatccgggctgtaccagaaggtctatacggccgagtacggccaattcggcggc
cagccgatcggcgcgatcgtcgcgaactacacgttcgggcccggcgcgcaggacgtcaag
ctgctgcagtacgtcgcgagcacgtcggcgatggcgcatacgccgttcatcgcggcggcg
ggccccgcgttcttcggcatcgattcgttcggcaagctgccgaacgtaaaggatctcgcc
tcgctgttcgaggggccgcaatacgcgaaatggaatgcgtttcgcgaaagcgaggacgcg
cgctacgtcggcctcacgctgccgcgcttcttgctgcggctgccttacggcgcgaacacg
acgcccgtcaagcgcttcaactacgaggagcgcgtcgacggcggcgacgcgcattttctg
tggggcaacgcggcgttcgcgttcgcgacgcgcctcaccgcgagcttcgccgactatcgc
tggtgcgcgaacgtgatcgggccgaaaggcggcggaacggtgaccgatctgccgctctac
gcgtacgaatcgatgggcgagatccagaacaagatcccgaccgacgtgctgatttccgag
cgccgcgagttcgagctcgccgaacagggcttcatcgcgctgacgatgcgcaagaacagc
gacaacgccgcctttttctccgcgaactccacgcagaagccgaagttcttcggcatcagc
aaggaaggcaaggaggccgagctcaactatcggctcagcacgcaactgccgtacatcttc
gtcgtcaaccggctcgcccattacatcaaggtgatccagcgggaaaacatcggctcgtgg
aaggagcgcggcgatctcgagcaggagctcaaccagtggatccgccagtacgtcgtcgac
atggacaacccgtcgcagagcgtgcgcagccgccgcccgctgcggcaggcgcagatcgtc
gtgtcggacgtcgagggcgaacccggctggtatcgcgtggacatgaaggtgcggccgcac
ttcaagtacatgggcgcgttcttcacgctgtcgctcgtcggcaagctcgaaaagcgctag

DBGET integrated database retrieval system