KEGG   Burkholderia pseudomallei K96243: BPSS1499
Entry
BPSS1499          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS1499
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS1499
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-GeneID: 3095205
NCBI-ProteinID: YP_111506
UniProt: Q63K66
Position
2:2043554..2044015
AA seq 153 aa
MADRESSRAGEPRTRERRLLERIANREAGGEHDRPPPADVLAHSIIDHLRRILNTRQGHV
PIDPAFGVPDFTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRF
SLDARLVIDAHDVPARFLTTVTGNGKIDIRTIS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggctgatcgcgaatcgtcgcgggccggcgagccgcgcacgcgcgagcgccggctgctc
gagcggatcgcgaaccgggaagcgggcggcgagcacgatcgcccgccgcccgccgacgtg
ctcgcgcactcgatcatcgaccacctgcgccgcatcctgaacacgcggcagggccacgtg
ccgatcgatcccgccttcggcgtgccggatttcacgaatctcgcgggcggcttcgcgcaa
ggctccgcccgcgaaatcgaagcgcagatcgagcgcgtgatcacctgctacgagccgcgg
ctgaaagcgccgcgcgtctcgctcgccgagcgcgggcccgatgcggcgacgctgcgcttc
agcctcgatgcgcggctcgtgatcgacgcgcacgacgtgccggcgcgctttctgacgacc
gtcaccggcaacggaaagatcgatatccgaacgatttcctga

DBGET integrated database retrieval system