KEGG   Burkholderia pseudomallei K96243: BPSS1501
Entry
BPSS1501          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS1501
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS1501
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-GeneID: 3096693
NCBI-ProteinID: YP_111508
UniProt: Q63K64
Position
2:2045782..2046804
AA seq 340 aa
MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDV
ERIDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPL
LFDAWLKHRLALRIVEERDEHALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRS
AAGLRALLADAFAPATVDIEPCVPQWLPIPDDQRTRVGTRARRLGADARVGARMRDDGAR
LRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAVDVVVRVRARDAAPARCGRRA
WSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcctgctctagaacccgttctgctcggcgaggcgaagcacttcgcgtatttccaggcg
atccggctgctgcggcgcatcgcgcgcgaacggcgcggcgacgccgcggggcggcccgac
gcgccgctgccgatccacacgcggccgaatctctcgctgtcgtttccggacaccgacgtc
gagcgcatcgacaaggccgacgacggcggctaccgggtcgtcgcgaacttcttcggtctg
tacggcgtgtcctcgccgctgccgacgttctacaccgaggacctgatcgacgaagcgttc
aggggccgccacgcggcgcgcggctttctcgacgtgctgcatcgcgcgctctatccgctg
ctgttcgacgcgtggctcaagcatcggctggcgctgcggatcgtcgaggaacgcgacgaa
cacgcgctgcgcccgctctacgcactcgcgggcgtcgacgcgcgcatcgcgcgcgacgcg
ggcctgcacgagcacgcgctgctgcgctacgtcgggctgctcagccagcggccgcgctcc
gcggccggtctgcgcgcgctgctcgccgacgcgttcgcgcccgcgacggtcgacatcgag
ccgtgcgtgccgcaatggctgccgattccggacgaccagcgcacccgcgtcggcacgcgc
gcgcgccggctcggcgccgacgcgcgggtcggcgcgcgcatgcgcgacgacggcgcccgg
ctgcggatcgtgctcggcgacgtgcccggcccgctgttccgcgcgctgatgccgggcggc
gatgcgtttgcccggctgcgcttgctcgtacgcctgtatctgacccaaccgttcgccgtg
gacgtcgtggtgcgcgtgcgcgcgcgcgacgcggcccccgcgcgctgcggccgccgcgcg
tggtcgcgcgtcgggctcgacgcgtggctgggcggcccgagcgcggaacgcgcggcgtcg
cccgaattccgtcttccgacttccctctttgatcaagcgagaccccatcatgctgctggt
tga

DBGET integrated database retrieval system