KEGG   Burkholderia pseudomallei K96243: BPSS1503
Entry
BPSS1503          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPSS1503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS1503
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS1503
SSDB
Motif
Pfam: Phage_GPD Phage_base_V LmeA
Other DBs
NCBI-GeneID: 3095009
NCBI-ProteinID: YP_111510
UniProt: Q63K62
Position
2:2049856..2052879
AA seq 1007 aa
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVS
RQLRIDFAKMLSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWR
LSLYKASDVYLNEQTIPDIVKRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVS
RWMEKEGLYYYFEHDGRHETLVIVDDRRHQPGPADDLALRYLPATSLDAGIEADRVQAFT
CRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVSSDEHFHTKDEGQRYAKLRAE
ALVCEGRRFAGESTAAGLRAGRFFALSGHYRQDFDGRYLVTALTHRGSQAHLLFPDLDAP
FGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAV
PNSSHRSVVTRRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLT
SGNKFDFSLGNAYSFSGGLKCSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGS
RSFEINDSASTLLQTLHKQSATGAIRLSAGQDASALLQKQLDKLKGTVRKFMIVSGLANA
GSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGATGVSTALMATSRTLLANVAKLQEALP
LVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSVGKGRWGVEAA
KHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSA
VRMSASDAQLGFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAA
GCGSASLKLGSDGAIDVSATDVKLNGTNVKLNGSASLKFDGQLIQLG
NT seq 3024 nt   +upstreamnt  +downstreamnt
atgccttcgtccccccgccacgatgcgcccgcgtcgcgcgcgaacgccgcgccgtccgcg
aacgcgcgacgcttcacgttcgcgagcgacgcgtacgaccccgcgacgttcgacgtcgtc
gacatcaacggccgcgacgcgatctcgcagccgtaccggttcgagatcacgctcgtgagc
aggcagttgcggatcgacttcgcgaagatgctgagccgcggggcgacgctcgcgatcctg
ccgccgttcggcgaggccggcaccacccgctatgccggcgtgctcgccgaattcgagcag
aagaagcgctttcgcgacttcaccgtctatcgcgcgacgctcgtgccgcgcctctggcga
ctatcgctgtacaaggcgtcggacgtctatctgaacgagcagacgattcccgacatcgtc
aagcgcgtgctgcgcgccgcctcgttcggcagccgcgatttccgcatgcggcacggcggc
ggctaccgcaagcgcagcttcgtctgccagtacgacgagagccatctcgatttcgtgtcg
cgctggatggagaaggaaggcctctactactacttcgagcatgacggccggcacgaaacg
ctcgtgatcgtcgacgaccgccgccatcagcccggccccgccgacgatctcgcgctgcgc
tacctacccgcgaccagcctcgacgcgggcatcgaagcggaccgcgtgcaggcgttcaca
tgccgggcgacgccgctgccgcgcgaagtcgtgctgcgcgacttcaaccaccgcaaggcg
gagctctcgctcgaagtccgcgagcgcgtggcgcgcgacggcgtcggcgagcgggtgtcg
agcgacgagcacttccacacgaaggacgaagggcagcgctacgcgaagctgcgcgccgag
gcgctcgtctgcgaagggcgccgattcgccggcgaatcgaccgcggccgggctgcgcgcc
ggccgcttcttcgcgctgtcgggccactaccgccaggatttcgacggccgctatctggtg
acggcgctcacgcatcgcggctcgcaggcacacctgctgtttcccgatctcgacgcgccg
ttcggcgcgacgccgggcgagcccatctaccgcgccgagttcgaggcgattgccgccgac
ctccagtaccggccgccgcgcacgacgcccaagccgcgcgcggcgggcgtcgtcagcgcg
atcgtcgacggcgagggcggcggcaagctcgccgagctcgacgaatacggccagtacaag
gtgcgctttccgttcgcgcacaccgcgcatccggcgaacaaggcctccgcgcgcatccgg
atggcgacgccctacgcgggcgacgaccgcggcatgcacctgccgctgctgaagcgcacc
gaagtgaagatcgcattcgacggcggcgatccggaccgccccgtgatcgtcggcgcggtg
cccaactcgtcgcaccgcagcgtcgtcacgcgccgcaaccccgccgagcatcgcatcctc
accgagcacaaccagctctacatgaaggacggcagcggcgcggcgacgtggctgcacgcg
ccgaacaaccacatcggcatcggcgcggtcgggccgggcgacggcctcgcgctcctcacg
tccggcaacaagttcgacttctcgctcggcaacgcgtacagcttctcgggcgggctcaag
tgctcggtgtcgatgggcggcaacaccgacgtctacgtcggcgtgcgcaacagcctcgac
gtcagcgcgaacttcctgacgacgctgcagggcaacctgcgctggatgctgcccggcagc
cggagcttcgagatcaacgacagcgcatcgacactgctgcagacgctgcacaagcagtcc
gcgacgggcgcgatccggctgtccgccgggcaggacgcgtccgcgctgctgcaaaagcag
ctcgacaagctcaagggcacggtgcgcaagttcatgatcgtgtcgggcctcgcgaacgcc
gggtccgcggccgccgccgcggggctcatcaagggcggcggcaagctcgccgatctgccg
tgggcgggcttcggcatatccgccgcgcagttcgccggcgcgaccggcgtcagcacggcg
ctgatggcgacctcgcgcacgctgctcgcgaacgtcgcgaagctccaggaggcgttgccg
ctcgtcgccgatctgtcgctcggcaagcagggcatcgcgctcgccgcgaagaacctcacg
cacgcgacgcggatgtcgctcaccgtcgacggcgtctcgtggtcgacgcacgcgaagggg
cccggcgcggcgggcgccgcgatgagcgtcggcaagggccgctggggcgtcgaagcggcg
aagcacgcgcacgtccacgcgagcgacacgctgctgttcgcggtgccggccgacccgacg
acccagttcgacctgaaggacctgatcgggctgcgccgcgatctcgacgaatgcatgaag
gacatcgccgatctcgaagccgacatttcggaaaacgaagtgctgtcgaccgatcagaac
acgttcggcgtcagcgcgctcatccccacgccgccgtcgcccgccggcgcgctcgcggcg
gtcgcgatcaaggtgaagcaagcgaagctcgtcgagctgaaggccaagcagaagctcgtc
gcgctgaaggtcgacaacctgcagcagaagttcgcgaagcacgtgcagcacctgagcgcc
gtgcggatgagcgcttccgacgcgcagctcggcttcaagggcaaccggctcgtcgcgacg
gccgacggcgtcacgctcgcgcatgcgcagggcaaggcgaagctcgacgtgcgcgaagcg
aagatcggcgtcacggcgggcaaatcgagcgtcgagctcgacgaaggcaagatcgcggcc
ggctgcggcagcgcatcgctgaagctcggcagcgacggcgcgatcgacgtgagcgcgacc
gacgtcaagctgaacggcaccaacgtcaagctgaacggcagcgcgtcgctgaagttcgac
ggccaactgatccagctcggctga

DBGET integrated database retrieval system