KEGG   Burkholderia pseudomallei K96243: BPSS1512
Entry
BPSS1512          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB
Motif
Pfam: Big_5 UCH
Other DBs
NCBI-GeneID: 3096758
NCBI-ProteinID: YP_111519
UniProt: Q63K53
Position
2:2065185..2066609
AA seq 474 aa
MNARRPAFGLIASHASRRRAVESVRAHFPLMFTLCLAMKHTSNHSDPSGAPSSARRAASD
SSRLVRGMRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAP
APTAHVSSGHTPPATAPAAMPTASPTATPTASPTATAAASPSAPSTATPNAPPAAPPAVV
ATRVPPTHAALRRPTIELEFDRAIEPGSVPHIALRADDGTSVAVGPLSWLSDRRIAFAPR
KPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFINTALQL
AVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRATPEVPDSGPGQT
LEVMQALRMPLYDTSSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFD
YSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEIAIYR
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaacgctcgacgtccggcgttcggcctgattgcgtcgcacgcgtcacgccgccgggcc
gtcgaatccgttcgcgcccactttccgctcatgttcaccctctgtcttgcgatgaaacac
acttcgaaccactccgacccttccggtgcgccgtcgtcagcgcgacgcgccgcatccgat
tcgtcccgcctcgtccgcggcatgcgctcgccccaacgcggcggcgcggcactggcgctg
gccgtcgcctcgctcgccggatgcgggggcggcgattcgggcgaacccgctccacgcgaa
ttcgcgcccccgacagtgcaactcgcctacccgacgcaaccgaactcgcccgtcgcacca
gcgcccaccgcgcacgtatcaagcggacacacgcctccggccacggcgcccgccgcgatg
cccaccgcttcacccaccgcgacgcctaccgcttcacccaccgcgacggctgccgcttcg
ccctccgcgccatccactgcgacgcccaacgccccgcccgccgctccgccggccgtcgtc
gccacccgcgtcccgccgacgcacgcggcgttgcgccgcccgacgatcgaactcgaattc
gatcgcgcgatcgagccgggttcagtcccacacatcgcgctgcgcgccgacgatggcacg
agcgtcgccgtcggcccgttgtcgtggctgagcgatcgccggatcgcgttcgcgccgcgc
aaaccgctcaagtcgaacagccgctacgaaatcatggtgcccgccggcatcaggagcacc
acgggcgaacggtcggctcatccgctaacgagcagcttcgataccgcgcccgtcacgccg
ccgcgcggcctgcccaatctcgacggcgcctcgtgcttcatcaacacggcgctgcaattg
gcggttcactcgtcggcgctcgacgacattctgtcgaacgaagccgtcccgcccgccgtc
cgcacgctgctcgaagactacgacgccgcatcggctgacgcactcgacgcgcagttggcc
gccgcggtcgccgcgctgcgcgccacgccggaggtcccggacagcgggccgggacaaacg
ctggaagtgatgcaagcgttgcggatgccgttatatgacacgagcagcgcgaacaacgca
acgaacaacgccgacgccatacgtcatgcgccgcccaacaccaaggcgttctttctgaac
tcctatccaccgctttcctacgcggatctgccgaaccacgaccggctcgtcgcgttcgac
tacagcacgggcggtcactatgtcgcttatgtgaagcgggatggaatctggtatcgaatc
gacgatgcccaggtcagcgccgtcaacgaacaggacttgcttgccctgccggcgttcaac
cccgctaacggcagcgtgtcgatcgaaatcgcgatctatcgatga

DBGET integrated database retrieval system