KEGG   Burkholderia pseudomallei K96243: BPSS1566Help
Entry
BPSS1566          CDS       T00203                                 

Definition
(RefSeq) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BPSS1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 3094892
NCBI-ProteinID: YP_111572
UniProt: Q63K00
Position
2:2124793..2126379
Genome map
AA seq 528 aa AA seqDB search
MNPLLSAAASEELGRTRHLGVALLVALLAAGVAYVFVHLFADLAPVGPRSAFPYLLLGVA
LAIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGLWNFLGVMASTGAVAFGILQL
LPVELILQVGHGAGFAMVFALLIAAIAWNLATWYFGLPSSSSHTLIGSIIGVGLANQLMH
GPSGTSGVDWAQAAGVGQSLLLSPLVGFLCAALLLAALKALVRVPALYREPQTNEPPPFW
VRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPGETQTFIAVAHR
ASETLARYAGAAQPSPNPRADVEAYVQSRRLSDATLPAVRRLSDALAAEVGATGSIAKVP
EGQADNVRNTMYLVSEALRLMEKTGRPALSPADRLALDDYRRQLDHATKFIPTWVKVAVA
IALGLGTMVGWRRIVVTVGEKIGKQHLTYGQGASAEVVAMLTIGAADAYGLPVSTTHVLS
SGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIVLAGALYWAFHALT
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccttctgtccgccgcggcgagcgaagagctcggtcgcacccggcatctgggc
gtcgcgctgctcgtcgccctcctcgccgccggcgtcgcgtacgtgttcgttcacctgttc
gcggatctcgcgcccgtcggcccacgctcggcgtttccgtatctgctgctcggcgtcgcg
ctcgcgatcgcgctcggcttcgagttcgtcaacggcttccacgacaccgcgaacgccgtg
gcgaccgtgatctacacgcattcgctgacgccgaacgtcgcggtcatctggtcgggcctc
tggaattttctcggcgtgatggcgtcgacgggcgcggtcgcgttcggcatcctgcaactg
ctgcccgtcgagctgatcctgcaagtcggccacggcgcgggcttcgcgatggtgttcgcg
ctgctgatcgcggcgatcgcgtggaatctcgcgacctggtacttcggcctgccttcgtcg
agctcgcacacgctgatcggctcgatcatcggcgtcgggctcgcgaatcagctgatgcac
gggccgtccggcacgagcggcgtcgattgggcgcaggcggcgggcgtcggccaatcgctg
ctgctctcgccgctcgtcggcttcctgtgcgcggccctgctgctcgccgcgctgaaggcg
ctcgtgcgcgtgcccgcgctctaccgcgagccgcagacgaacgagccgccgccgttctgg
gtccgctgcctgctgatcctgacctgcaccggcgtgtcgttcgcgcacggctcgaacgac
gggcagaaaggcatggggctcatcatgctgatcctgatcggcaccgtgccgaccgcatac
gcgctcaacaaggcggtcacgcccggcgagacgcaaacgttcatcgccgtcgcacaccgc
gcgtccgaaacgctcgcccgctacgcgggcgccgcgcagccgtcgccgaacccgcgcgcc
gatgtcgaggcttacgtgcagtcgcgccgcctgagcgacgcgacgctgcccgcggttcgc
cggttgtcggacgcgctcgcggccgaagtcggcgcgacgggctcgatcgcgaaagtgccc
gaggggcaggcggacaacgtgcgcaacacgatgtatctggtgtccgaagccctgcgcctg
atggagaaaaccggccggccggcgctctcgccggcggatcgcctcgcgctcgacgactac
cgcaggcagctcgaccacgcgaccaaattcattccgacctgggtgaaggtcgcggtggcg
atcgcgctcggcctcggcacgatggtcggctggcggcgcatcgtcgtgaccgtcggcgag
aagatcggcaagcagcatctgacctacgggcaaggcgcgtcggcggaagtcgtcgcgatg
ctcacgatcggcgcggccgatgcgtacgggctgccggtgtcgacgacgcacgtgctgtct
tccggcgtcgcgggcacgatggccgcgaacggctccgggctgcaatggagcacggtgcgc
agcctcgtgctcgcgtgggtgttgacgctgcccgcgtcgatcgtgctcgcgggcgcgctc
tattgggctttccacgcgctgacctga

DBGET integrated database retrieval system