KEGG   Burkholderia pseudomallei K96243: BPSS1863Help
Entry
BPSS1863          CDS       T00203                                 

Definition
(RefSeq) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BPSS1863
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bps01002]
    BPSS1863
Enzymes [BR:bps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     BPSS1863
Peptidases [BR:bps01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   BPSS1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 3095108
NCBI-ProteinID: YP_111867
UniProt: Q63J55
Position
2:complement(2530933..2531631)
Genome map
AA seq 232 aa AA seqDB search
MTIEVGLLLFPQVQQLDLTGPHDVFASLPGVTVRLVWKTREPVASSSGLVLAPNATFDDC
PPLDVICVPGGIGVADLMEDADTLAFLRRHAAHARYVSSVCTGALVLGAAGLLRGRRATT
HWAFHSLLAPFGATPVRERVVRDGNLVTGGGVTAGIDFALTLAAELVGEDDAQAVQLQLE
YAPAPPFAAGDPDTAPARIVERMRERSKPVLARREQVVARAVAALERRRADG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaagtgggattactgttgtttccgcaggtgcagcagctcgacctgaccggc
ccgcacgacgtgttcgcatcgctgcccggcgtcacggtgcggctcgtgtggaaaacgcgc
gagccggtggcgtcgagcagcgggctcgtgcttgcgccgaacgcgacgttcgacgattgc
ccgccgctcgatgtgatttgcgtgccgggcggcatcggcgtcgccgatctgatggaggat
gcggacacgctcgcgtttttgcgccggcacgcggcgcatgcgcgctacgtgagctcggtg
tgcacgggcgcgctcgtgctcggcgcggcggggctgctgcgcgggcggcgcgcgacgacg
cactgggcgttccattcgctgctcgcgccgttcggcgcgacgccggtacgcgagcgcgtc
gtgcgcgacggcaatctcgtgacgggcggcggcgtgaccgcggggatcgatttcgcgctg
acgctcgcggccgagctcgtcggcgaggacgatgcgcaggcggtgcagttgcagctcgaa
tatgcgccggccccgccgttcgcggcgggcgatccggataccgcgccggcgcggatcgtc
gagcgcatgcgcgagcggtcgaagccggtgctcgcgcggcgcgagcaggtggtcgcgcgc
gccgtggcggcgctcgagcggcggcgcgccgacgggtga

DBGET integrated database retrieval system