KEGG   Burkholderia pseudomallei K96243: BPSS1983Help
Entry
BPSS1983          CDS       T00203                                 

Definition
(RefSeq) deoxyribonuclease
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
bps  Burkholderia pseudomallei K96243
Brite
Enzymes [BR:bps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     BPSS1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 3096355
NCBI-ProteinID: YP_111989
UniProt: Q63IT3
Position
2:2681882..2682934
Genome map
AA seq 350 aa AA seqDB search
MTISPRDEQNRSVDLWFAYKVPKLTKDTDSDSATGYEYVYYDREIGSVQKSPNRMNNPKG
ALFYTLDSIFGDPGSTTGWILYNDEMPADADRSNNATLGHTKGVIAFDIASNSALWLLHS
WPKYTSPSAPGVPTPLYGQTFLCVSLDLETAGKIAAQMALHQQPQVYLPRTAGLDHASPL
YTLTQPLNASAPGDSDSLDFKTRGGAPFKVIAKNRKWGKDFWNDLVGPTLKADMDVETWI
RGKIPPILDSDGVHKTYDIKFIDLRKLGAPWAWPETQDHAKWGITTTDDWVCVGDINRMV
TQEKRGGGTIAFQDPQLWKALSQTDLIVPPPGKTEAQARAMIHRTHQPAD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactatctcgccgcgcgacgaacagaatcgatcggtcgatctatggttcgcctacaaa
gtgccgaagctcacgaaggataccgacagcgacagcgcaaccggctatgaatacgtgtat
tacgatcgcgaaatcgggtcggtgcagaagtcgccgaatcggatgaacaacccgaaaggg
gcgctgttctacacactcgattcgatcttcggcgatccgggcagcacgacgggctggatt
ctctacaacgacgaaatgccggccgatgcggaccgttcgaacaacgcgacgctcggccat
acgaaaggcgtgatcgccttcgacatcgcgtcgaactccgccttgtggctgctgcactcg
tggccgaaatacacgagcccgtcggcccccggcgtgccgacgccgctgtacgggcagacg
ttcctgtgtgtgagcctcgatctcgagacggcaggcaagatcgccgcgcagatggcgctg
catcagcagccgcaggtctacctgccgcgcaccgccgggctcgatcacgcgagcccgcta
tacacgctcacgcagccgctcaacgcgtccgcgcccggcgattcggattcgctcgacttc
aagacccgcggcggcgcgccgttcaaggtgatcgcgaagaatcgcaagtggggcaaggat
ttctggaacgatctcgtcggcccgacgctgaaggccgacatggacgtcgagacatggatc
cgcggcaagatcccgcccattctcgactccgacggcgtgcacaagacctacgacatcaag
ttcatcgatctgcgcaagctcggcgcgccatgggcatggcccgaaacgcaggaccatgcg
aaatggggcatcacgacgaccgacgactgggtgtgcgtcggcgatatcaatcgaatggtg
acgcaggaaaagcgcggcggcggcacgatcgccttccaggatccgcaattgtggaaggcg
ctgtcgcagaccgatctgatcgtgccgccgcccggcaagaccgaagcgcaggcgcgcgcg
atgatccatagaacgcaccagccggccgactag

DBGET integrated database retrieval system