KEGG   Burkholderia pseudomallei K96243: BPSS2093
Entry
BPSS2093          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPSS2093
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS2093
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS2093
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF2345
Other DBs
NCBI-GeneID: 3095598
NCBI-ProteinID: YP_112092
UniProt: Q63II0
Position
2:complement(2831227..2833431)
AA seq 734 aa
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQ
DESERHLNGIVARAALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVL
GTYGFPIENHLTDTYAPRDYCVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAM
ASHVALPGYEHIPFIARDRTAIADEEHIDSWLPAQEVSIGKHETSDYDYTKPRADLSAQK
IDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEHERALARTDVRGIAPGYLFT
LEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLPYRSPRATPRP
RTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHS
NAFRFEDKKGAEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQ
NETVNIGKHRVAQIGGNETHGVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTE
TIGQGKTLNVTQHYQTTSKSMKTAVAEHHAEEIGSRTSTIEKAHELNVGGSQSVNVGASH
TMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTVESSASGSHSVRGKTVTSSAT
GEHTVEGTILKLNP
NT seq 2205 nt   +upstreamnt  +downstreamnt
gtgacccgcgtgttcacactcgacagcctgcacggcgacgacctgaagttccaccggctc
tacggcgaggaagcgctcgggcggatgttcgacttccggatcgaagcgctcgccgacaat
cacagcctgtcgctgaaggaactgctcggcaagccggtgacggtgcgcatccggcagcag
gacgaatcggagcgccatctgaacgggatcgtcgcgcgcgccgcgctggtcgggcggcgc
gcggagcggcattacggctatcaactgatcgtgcggccgtggctgtggctcgcgacgcgc
cgctccgattgccggatcttccagaacaagacggtgccggaaatcgtgcaggacgtgctc
ggcacgtacggctttccgatcgaaaaccatctgaccgacacgtacgcgccgcgcgactac
tgcgtgcagtacaacgagaccgacgcggcgttcgtgtcgcggctgatggagttcgaaggg
atctactactacttcaagcacgccgcgcaaacgcacacgctgatgctgtgcgacgcgatg
gcgtcgcacgtcgcgctgccgggctacgagcacattccgttcatcgcgcgcgaccgcacc
gcgatcgccgacgaagagcacatcgacagctggctgcccgcgcaggaagtgagcatcggc
aagcacgagacgagcgactacgactacacgaagccgcgcgcggatctgtccgcgcagaag
atcgatccgcgcggccacgaccatgacggcttcgcgtcgttcgaatggcccggcggctat
cgcgacgatgaaccgggcgcgcattacagccgcgtgcggctcgaagagcagcaggcggag
cacgaacgcgcgctcgcgcgcaccgacgtgcgcggcatcgcacccggctatctgttcacg
ctcgaacactgcccgcgcgccgaccagaaccgcgaatacctgatcgtgcgctgccagtat
cggtttcaggagaacgcgtacgcgaccgatagcggcaacgaggcggtcgtgcacgaatct
cagacactcgtgcagccttcgagcttgccgtatcgctcgccgcgcgcgacgccgcggccg
cgcacgaacggcccgcagacggcgaccgtcgtcggcccgaagggcgaggaaatctggacg
gaccagtacgggcgcgtgaagctgcaatttcgctgggaccgctacgggcagagcgaccag
aactcgtcgtgctgggtgcgcgtgtcgagcccgtgggcgggcggcggcttcggcggcgtg
cagatcccgcgcatcggcgatgaggtggtggtcgatttcctgaacggcgaccccgatcag
ccgatcgtgacggggcgcgtgtacaacggcgagaagatgccgccatgggggctgcccggc
agcgcgacacaaagcgggctgctgtcgcgctcgtcgccgggcggcacggccgagcattcg
aacgcgtttcgcttcgaggacaagaagggcgcggagcagctgtggatgcatgcggagcgc
aacttcgacgcggagactgagcaggaccacacgctgtcggtgggccacgatcattcgcat
tcggtcggcaacaacgagatgatgagcgtcgcgaacgaccggcaaaggagcgtcgggcag
aacgagacggtgaacatcgggaaacatcgcgtcgcgcagatcggcgggaacgagacgcat
ggcgtcgcgggaaaccgcacgcggcaggtcggacagaacgaagccgtgacgatcggcgcg
aatcgcgaggcgacgatcggcggcaatcacgtggagacggtcgcgaaagacaagaccgaa
acgattgggcagggcaagacgctgaatgtcactcagcactatcagacgacttcgaagagc
atgaagaccgctgtcgccgaacatcacgccgaggagatcggctcgcgaacgtcgacgatc
gagaaagcgcacgagctcaacgttggcggttctcaatcggtgaacgttggcgcgagccac
acgatgagcgtgaagaacaacgtacatgtcggcgcgggcgatcagatctcgctcgtttgc
ggcgatgcgagcatcacgctgaagaaggacggcacgatagcgatcaacggcgtcacggtg
gaatcgagcgccagcggaagccatagcgtgcgcggcaagacagtgacgtcgtcggcgacg
ggcgagcacacggtggaaggcacgatactgaaactgaacccctga

DBGET integrated database retrieval system