KEGG   Burkholderia pseudomallei K96243: BPSS2096
Entry
BPSS2096          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS2096
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS2096
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-GeneID: 3095467
NCBI-ProteinID: YP_112095
UniProt: Q63IH7
Position
2:complement(2837548..2839419)
AA seq 623 aa
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARV
QLKMDAEFPRFTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARP
AAAEQTACEFRTAHDLTLWPLELAGASVTGAPAYLPRSATAARRDVRGALRIRLKARGGA
GLAQLPIDRLMFHLAGPERDALHLLELIAGHTIGVVCHDAAQPPRWLHALGAHALAHQGF
DADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRPALARATGDTFELTLLLDRHD
AALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLDYEVYAVRRLA
GEQRDDGQMRAFRPFHASFAGDGGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAMIRGPSRPR
PPLADAQSAWRLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRV
AFAPVFRRLPAAGPLMFGRGVQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAEC
VLSSAQRGRLAQWPARVGRRPAI
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggatacgcgcctgctcgactactacaaccgcgagctcgcgtatctgcgcgagttgggc
ggcgagttcgcgcagcagtttccgaaagtggccgcgcgcctgcggatgcacgaatcgggg
ccgcccgatccgtacgtcgagcggctgctcgaaggcttcagctttctcaccgcgcgcgtg
caactgaagatggacgcggagtttccgcgcttcacgcaggcgctgctcgacgcggtgtat
ccgggttacgtcgcgccgcttccgtcgatggcgatcgtgcagttcacgccgatgatgaac
gaaggcagcctcgcgcagggctaccggctgccggcgggcaccgcgctgcgcgcgcggccc
gccgcggccgaacagaccgcgtgcgagtttcgcaccgcgcacgatctgacgctgtggccg
ctggagctcgcgggcgcttcggtgacgggcgcgcccgcgtatctgccgcgttcggcgacg
gccgcgcgccgcgacgtgcgcggcgcgctgcgcatccggctgaaggcgcgcggcggcgcg
ggcctcgcgcaactgccgatcgatcggctgatgttccacctggcgggccccgagcgcgac
gcgctgcatctgctcgaactgatcgccgggcatacgatcggcgtcgtctgccacgacgcg
gcgcagccgccgcgctggctgcacgcgctcggcgcgcacgcgctcgcgcatcagggcttc
gacgccgatcaggcgctgctgcccgacgaaggccgcagcttccacggttaccggctgctg
cgcgagtacttcgcgtttcccgcgcgcttcctgttcttcagcatcgaaggattgcggccc
gcgctcgcgcgcgcgacgggcgacacgttcgagctgacgctgctgctcgatcggcacgac
gcggcgctcgagaacagcgtcgatgcgcggcacctcgcgttgaactgcacgccggccgtc
aacctgttcgcgcggcgcgcggaccgcattccggtccatccgggcgcgcgcgagcatcat
gtcgtcgtcgatcgcagccggccgctcgactacgaggtctacgcggtgcggcggctcgcg
ggcgagcagcgcgacgacgggcagatgcgcgcgttccggccgttccatgcgtcgttcgcg
ggcgacggcggcaattacggcgcgtactacacggtgcgccgcgagccgcgcctcgtgtcc
gcgcaggcgcgcgcgaacggcacgcgcaccggctacgtcggcagcgagacgttcgtgtcg
ctcgtcgatagcgcgtgcgcgccgtatgacgaatcgatccgctatctgtccgtcgacacg
ctgtgcacgaaccgcgatctcgtcctgctgttgccggcgggcgacgcgaacgcgttcacg
ctgcgcgtgtcggcgcccgtcgagcggatcgccatgatccgcgggccgtcgcggccgcgc
ccgccgctcgccgacgcgcagagcgcgtggcggctcgtgagccatctcgggctcgcgcgc
cacacgctgaccgatgtcgacgacgaagaaggcgcgcgcgtgctgcgcgaattgctcggt
ctgcacgcggacccggccgatgcggcgatgcgccggcagatcgacggtgtgcatcgtgtc
gcgttcgcgccggtgtttcgccggctgcccgccgccgggccgctgatgttcgggcgcggc
gtgcaggtggacgtgaccgtcgacgatcatgcgttctccggcgacagcccctatttgctc
ggcgcggtgctcgagcagtttttcgcgcggcacgtgtcgatcaactcgttcgccgaatgc
gtgctgagcagcgcgcagcgcggcaggctcgcgcaatggccggcgcgcgtcggcaggcgg
cccgcgatatga

DBGET integrated database retrieval system