KEGG   Burkholderia pseudomallei K96243: BPSS2098
Entry
BPSS2098          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K06887  uncharacterized protein
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BPSS2098
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 3095171
NCBI-ProteinID: YP_112097
UniProt: Q63IH5
Position
2:complement(2839991..2840482)
AA seq 163 aa
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAA
YMDKGATAIIKNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAA
DRLMMQYGFQAAKVKKQYWQQNDNGGKGAEVSVGWNIKENTEM
NT seq 492 nt   +upstreamnt  +downstreamnt
atgggcgtcgcaatgtttatgaaagtggacggcgtcaccggcgaatcggccgacgcgcag
cacaagggctggaccgacatccagtcgttctcatggggcgcgagccagccgggcgcgatg
gcgagcggcagcggcggcaacgcgggcaaggcgagcttcaacgatctcgtcgtcgccgcg
tacatggacaagggcgcaacggcgatcatcaagaactgcgcgagcggcaagcacctgccg
acggtcgagatatcggcgtgcaagacgggcggctcgcagatcgagttcatgcgcgtgacg
ctgcaggaagtgctcgtcacgtccgcgcagatcgcgggcgtggacccgggcgacgcggcc
gaccggctgatgatgcagtacggttttcaggccgcgaaggtcaagaagcagtactggcag
cagaacgacaacggcggcaagggcgccgaagtgtcggtcggctggaacatcaaggagaac
accgagatgtga

DBGET integrated database retrieval system