KEGG   Burkholderia pseudomallei K96243: BPSS2107
Entry
BPSS2107          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPSS2107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS2107
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS2107
SSDB
Motif
Pfam: T6SS-SciN DUF4893
Other DBs
NCBI-GeneID: 3095961
NCBI-ProteinID: YP_112106
UniProt: Q63IG6
Position
2:complement(2853944..2854462)
AA seq 172 aa
MRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSPIVLKVFQLK
TASAFESADFFSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRV
LEKNRWRMTVPLPRAKQLNLYRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcgaccgcggttcagtgtttccgtcgttctgggatgcgcgctgctgctcgccggatgc
ggggcgaccgagcgttccgttgcggtgccgtattcgatcacgctcgacgtcgcgcccgac
gtcaatccggacctcaatcgcaagccgtcgccgatcgtgctgaaggtgttccagctgaag
acggcgtccgcgttcgaaagcgccgatttcttctcgctgcaggacaagccgcagagcgtg
ctcggcgcggatctgctcggcgtcgaccggatcatcctgcgcccgggggatgcgcgcacg
ctgcactatcgcggcaacgtcgacgcgggcgcgatcggcatcgtcgccgaatatcgcgtg
ctcgagaagaaccgctggcggatgacggtgccgctgccgcgcgcgaagcaactgaacctg
taccgattctggcaaacctcgccgggcgagatgaagctgcaggtcgccgtgaagaacggc
ggcatcggcctcggcggcgattcgcgagtacgccaatga

DBGET integrated database retrieval system