KEGG   Burkholderia pseudomallei NAU35A-3: BBU_1459Help
Entry
BBU_1459          CDS       T03476                                 

Definition
(GenBank) gamma-glutamyltranspeptidase family protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00430  Taurine and hypotaurine metabolism
bpsa00460  Cyanoamino acid metabolism
bpsa00480  Glutathione metabolism
bpsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BBU_1459
   00460 Cyanoamino acid metabolism
    BBU_1459
   00480 Glutathione metabolism
    BBU_1459
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpsa01002]
    BBU_1459
Enzymes [BR:bpsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BBU_1459
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BBU_1459
Peptidases and inhibitors [BR:bpsa01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BBU_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AIS88862
Position
1:complement(1763779..1765443)
Genome map
AA seq 554 aa AA seqDB search
MNLHSNLSGAPFSWRNPYPTTRVPVFARNVVSTSHPLAAQAGLRMLWKGGNAVDAAIAAA
AAITVVEPVSCGLGGDAFALVWDGAKLHGLNASGVAPAAWSVDYFRRRHGEAGNGLARQP
VRGWDTVTVPGVIAGWEALHAKFGTLPFADLLEPAIELAERGHAVAAVVAHKWAAAVPEL
SGQPGFAQTFMPHGRAPDVSERVRLPGHARTLRTIAAEGARAFYEGSLAESIAAFFRDGG
GVLTLDDLRAYRPEWVEPIGKDFRGYTVHEIPPNGQGIAALIALGIVERFGLDDLPLDSA
QAQHVQIEAMKLAFADVYRYVADPRAMELTPAQMLDDAYLAARAKLIDPRRATHFSFGMP
RAGGTIYLSAADERGMMVSFIQSNYMGFGSGLVVPGTGIALQNRGCGFSMDPASPNVVAG
GKRPFHTIIPAFVTQQAGSARHAVMSFGVMGGDMQPQGHLQTVVRMLGYGQQPQAACDAP
RWKVSRSFTLDVEATFDASVVEALAARGHTIQAIDDPYMDFGSGQFIWRLDRDEPDRGYV
AASDSRRDGLAAGF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcattcgaacctgtccggcgcgccgttctcgtggcgcaatccgtatccgacg
acgcgcgtgccggtgttcgcgcgcaacgtcgtgtcgacgtcgcatccgctcgccgcgcag
gcggggctcaggatgctgtggaagggcggcaacgccgtcgacgcggcgatcgccgcggcg
gcggcgatcaccgtcgtcgagccggtgtcgtgcggcctcggcggcgacgcgttcgcgctc
gtctgggacggcgcgaagctgcacggcctgaacgcgtcgggcgtcgcgcccgccgcgtgg
agtgtcgactattttcgccggcggcacggcgaggcgggcaacggtctcgcgcggcagccg
gtgcgcggctgggacacggtgacggtgcccggcgtgatcgccggctgggaggcgctgcat
gcgaagttcggcacgctgccgttcgccgatctgctcgagccggcgatcgagcttgccgag
cgcgggcacgcggtggccgcggtggtcgcgcacaagtgggcggccgccgtgccggagctg
agcggccagccgggcttcgctcaaaccttcatgccgcacggccgcgcgcccgacgtgagc
gagcgggtgcggctgccgggccatgcgaggacgctgcgcacgatcgcggccgaaggcgcg
cgcgcgttctacgaaggcagcctcgccgagtcgatcgccgcgttcttccgcgacggcggc
ggcgtgctcaccctcgacgacctgcgcgcgtaccgccccgagtgggtcgagccgatcggc
aaggacttccgcggctacacggtgcacgagattccgccgaacggccaggggatcgccgcg
ctgatcgcgctcggcatcgtcgagcgcttcggcctcgacgatttgccgctcgattcggcg
caggcgcagcatgtgcagatcgaggcgatgaagctggcgttcgccgacgtctatcgctac
gtcgccgatccgcgtgcgatggaactcacgcccgcgcagatgctcgacgacgcgtacctc
gccgcgcgcgcgaagctgatcgaccctcggcgcgcgacgcatttctcgttcggcatgccg
cgcgcgggcggcacgatctacctgtcggcggccgacgagcgcgggatgatggtgagcttc
atccagtcgaactacatgggtttcggctcgggcctcgtggtcccgggcacggggattgcg
ctgcagaaccgcggctgcgggttctcgatggacccggcttcgccgaacgtcgtcgcgggc
ggcaagcggccgttccacacgatcattccggcgttcgtcacgcagcaggcgggcagcgcg
cggcacgcggtgatgagcttcggcgtgatgggcggcgacatgcagccgcaaggccatctg
cagacggtcgtgcggatgctcggctacggccagcagccgcaggccgcgtgcgacgcgccg
cgctggaaggtgagccgctcgtttacgcttgatgtcgaggccacgttcgatgcgtccgtc
gtcgaggcgctcgccgcgcgcggccatacgatccaggcgatcgacgatccgtacatggac
ttcggctccggccagttcatctggcggctcgatcgcgacgagcccgaccgcggctatgtc
gcggcgagcgacagccggcgcgacggcctcgcggccggcttctga

DBGET integrated database retrieval system