KEGG   Burkholderia pseudomallei NAU35A-3: BBU_19Help
Entry
BBU_19            CDS       T03476                                 

Gene name
pcp
Definition
(GenBank) pseudomonalisin
  KO
K05998  pseudomonalisin [EC:3.4.21.100]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpsa01002]
    BBU_19 (pcp)
Enzymes [BR:bpsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.100  sedolisin
     BBU_19 (pcp)
Peptidases and inhibitors [BR:bpsa01002]
 Serine peptidases
  Family S53
   BBU_19 (pcp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Motif
Other DBs
NCBI-ProteinID: AIS87365
Position
1:19585..21471
Genome map
AA seq 628 aa AA seqDB search
MTSRKWARSRASQAKHAIYAATFFAAAALSAHAAAAWVDTQTGAYPALAQQALAASQASA
AATAAGKAIDTAPGEPVRVVVSLNLNDEARLDRFLRDLHTPGSAAYGRHLTPAEFAAQYA
PTPQQVALVEAHLRRAGFRDIEVAPNRLLISATGTAAAVKTAFNTRLKRFTLEGRRVYAN
QDAAQVPAELGRIVGAVLGLDNATLARTYNRQAAVTGAVGGAKASLAARASDASAAASGA
PVLTGHDPLEFSRIYRAGSTPTASQTTVGVIMAGDAAPVLRDLDTFAAKAGLARVAATVT
RTGPPGSDYSDNSGLSEWDMDSQAIVGAAGGAVKGLVLYAAPSMLLSDITSAYNRAVVDN
VAKVINVSLGVCEADARASGTQAADDRIFKSAVAQGQTFVVAAGDAGAYECSVSRVSGGQ
GVPARSNYSVSEPATSPYVVAVGGTTLSTDRTTLAYAGEVAWNEGLQPIGVYDAYGSYDG
TRRLWATGGGYSRSEAAPAWQRSVLGASAKARALPDVAFDADGRSGAHVYVNGRTEQWGG
TSLAAPIFTGIWARVQSDNGNRLGFPLASLYRYAPANGAFAHDVKSGNNGSGGYGYKAGA
GWDPVTGFGSLDIANFAAFVKQTADFAR
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaagaaaatgggccaggtctcgcgcttcgcaggcgaagcatgcgatttacgcg
gcgacgttctttgccgcggcggcattgagcgcgcacgcggcggcggcatgggtcgacacg
caaaccggcgcgtatccggcgcttgcgcagcaggcgcttgccgcgtcgcaagcttcggcg
gcggcaaccgcggccggaaaggcgatcgacacggcgcccggcgagccggtgcgggtcgtc
gtcagtctcaatctcaacgacgaagcgaggctcgatcgcttcctgcgcgatctgcatacg
cccggcagtgccgcctacggccggcatctgacgcccgccgaattcgccgcgcagtatgcg
ccgacgccgcagcaggtcgcgctcgtcgaagcgcatctgcgccgggccggattccgcgac
atcgaggtggcgccgaaccggctgctgatctcggcgacgggcaccgccgccgcggtcaag
acggcgttcaacacgcggctcaagcgctttacgctcgaaggccggcgcgtgtatgcgaac
caggacgcggcgcaggtgcccgccgagctcggccgaatcgttggcgcggtgctcgggctc
gataacgcgacgctcgcgcgcacgtacaaccgccaggcggcggtgacgggcgcggtcggc
ggcgcgaaggcgtcgctggccgcgcgcgcgagcgacgcgtcggccgccgcgagcggcgcg
cccgtgctgacgggacacgatccgctcgaattctcgcgaatctatcgcgcgggctcgacg
ccgacggcgtcgcagacgacggtcggcgtgatcatggcgggcgatgcggcgcccgtgctg
cgggatctcgatacgttcgcggcgaaggccgggctcgcgcgcgtcgcggcgacggtcacg
cgtaccgggccgcccggcagcgattacagcgacaattcgggcctgagcgaatgggatatg
gacagccaggcgatcgtcggcgcggcgggcggcgcggtgaaggggcttgtgctctacgcg
gcgccctcgatgctgctctccgacatcacctcggcgtacaaccgcgcggtcgtcgacaac
gtcgcgaaggtgatcaacgtgtcgctcggcgtgtgcgaggcggacgcacgcgcgtccggc
acgcaggcggcggacgaccgcatcttcaagagcgcggtcgcgcaggggcagacgttcgtc
gtcgcggcgggcgacgcgggcgcgtacgaatgcagcgtgagccgcgtgtcgggcgggcag
ggcgtgccggcgcgatcgaactattcggtgagcgagcccgcgacgtcgccgtacgtcgtc
gcggtcggcggcacgacgctgtcgaccgacaggacgacgctcgcctacgcgggcgaagtc
gcatggaacgagggcttgcagccgatcggcgtgtacgacgcgtacggcagctacgacggc
acgaggcgtctgtgggcgacgggcggcggctacagccgaagcgaagcggcaccggcgtgg
cagcgaagcgtgctcggcgcgtcggcgaaagcgcgcgcgctgcccgatgtcgcattcgat
gcggacggccgcagcggcgcgcacgtctacgtgaacggccggaccgagcaatggggcggc
acgagcctcgcggcgccgatcttcacgggcatctgggcgcgcgtgcaatccgacaacggc
aaccggctcggttttccgctcgcgagcctctatcgctacgcgccggccaacggcgcgttc
gcgcatgacgtgaaatccggcaacaacggctcgggcggctatggctacaaggccggtgcg
ggctgggatccggtgacgggcttcggcagcctcgacatcgcgaacttcgccgcgttcgtc
aagcagacggccgatttcgcgcgataa

DBGET integrated database retrieval system