KEGG   Burkholderia pseudomallei NAU35A-3: BBU_2041Help
Entry
BBU_2041          CDS       T03476                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00071  Fatty acid degradation
bpsa00072  Synthesis and degradation of ketone bodies
bpsa00280  Valine, leucine and isoleucine degradation
bpsa00310  Lysine degradation
bpsa00362  Benzoate degradation
bpsa00380  Tryptophan metabolism
bpsa00620  Pyruvate metabolism
bpsa00630  Glyoxylate and dicarboxylate metabolism
bpsa00640  Propanoate metabolism
bpsa00650  Butanoate metabolism
bpsa00900  Terpenoid backbone biosynthesis
bpsa01100  Metabolic pathways
bpsa01110  Biosynthesis of secondary metabolites
bpsa01120  Microbial metabolism in diverse environments
bpsa01130  Biosynthesis of antibiotics
bpsa01200  Carbon metabolism
bpsa01212  Fatty acid metabolism
bpsa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBU_2041
   00630 Glyoxylate and dicarboxylate metabolism
    BBU_2041
   00640 Propanoate metabolism
    BBU_2041
   00650 Butanoate metabolism
    BBU_2041
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBU_2041
   00072 Synthesis and degradation of ketone bodies
    BBU_2041
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBU_2041
   00310 Lysine degradation
    BBU_2041
   00380 Tryptophan metabolism
    BBU_2041
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBU_2041
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBU_2041
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBU_2041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpsa04147]
    BBU_2041
Enzymes [BR:bpsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBU_2041
Exosome [BR:bpsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBU_2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIS87852
Position
1:complement(2419935..2421140)
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTRAVDDVVLGCVEPV
GEQGACIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSEMAIGGGVESM
SRVPMGSSGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAA
QAGWFARSIVPVRDANGLTILDHDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARIRSFASIGSEPSIMLTG
PAYAAQKALERAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgattcgcgac
cgcaacggtctcgacacgcgcgccgtcgacgacgtcgtgctcggctgcgtcgagcccgtc
ggcgagcaaggcgcgtgcatcggccgcatcgcggtgctcgcggccggctacgcggaaacc
acggccggcgtgcagatcaaccgcttctgcgcatcgggcctcgaggcgtgcaacatggcc
gccgcgcaggtgatgtccggccagtcggagatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggctcgagcggcggcgcgtggcccgtcgatccggcgatcgcgatt
ccgagctatttcgtgccgcagggcgtatcggccgacacgatcgcgacgaagtggggctac
agccgtgccgatgtcgacgcgtacgccgccgagagccaccgccgcgcgcacgcggcggcg
caggcgggctggttcgcgcgctcgatcgtgccggtgcgcgacgcgaacggcctgacgatc
ctcgatcacgacgagacgatccgcccgcagacgacgcccgagacgctcgcgacgctcaag
ccttcgttcgccgaactgggtgagatgtacggcttcgacgcggtgatccgccagcgctat
ccggagctcgaacgcatcgagcacgtgcaccacgcgggcaacagctcggggatcgtcgac
ggcgcgtcggccgtgctgatcggctcgctcgaggcgggcaagcgcgcgggcctcgcgccg
cgcgcgcgaatccgctcgttcgcgagcatcggctcggagccgtcgatcatgctgacgggg
ccggcctacgcggcgcagaaggcgctcgagcgcgccggcatgcgcgcggccgacatcgac
ctgtacgagctgaacgaagcgttcgcgtcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgaccggatcaacgtgaacggcggcgcgatcgcgatgggccatccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgagctcgagcggcgcggcgcggcc
acgggccttgcaacgctgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system