KEGG   Burkholderia pseudomallei NAU35A-3: BBU_581Help
Entry
BBU_581           CDS       T03476                                 

Definition
(GenBank) phosphoesterase family protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00562  Inositol phosphate metabolism
bpsa00564  Glycerophospholipid metabolism
bpsa01100  Metabolic pathways
bpsa01110  Biosynthesis of secondary metabolites
bpsa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BBU_581
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBU_581
   00565 Ether lipid metabolism
    BBU_581
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBU_581
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bpsa02042]
    BBU_581
Enzymes [BR:bpsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BBU_581
Bacterial toxins [BR:bpsa02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BBU_581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AIS87013
Position
1:707081..708568
Genome map
AA seq 495 aa AA seqDB search
MANSLSRIEHIVHLMLENRSFDQMLGFLYTDDGNRSPTGQPFDGLTGNESNPDDLGRPVG
VYRIRATDPHPYLMPGADPGEGFQNTNYQLFCDDHPAPGAVPTNQGFVVNFKSAIATDQS
RHDKDALPGTTPEQIMGMYTPELLPVLSGLAKGYAVCDRWFASAPTMTMPNRAFALAATS
QGHLDDHVKIFTCPSIFGRLSDQGVDWAIFGYNRDPLTRHDFPDTQNADDSHFGHFRDFQ
ARAASGTLPAFTFLEPSWDASGNSQHPNYDVAAGEQLIHDVYYALRNGPGWNSTLFIVTY
DEHGGNYDHVAPPSGATPPGDGTVGEFGFDFTRFGVRVPAVLVSPLIAAGTVFRSAAGTI
DHTSVLKTIGERFGTAPLTARDRAAPSLGDALTLASPRAASDDPLAGVTVPVSRVSHPNA
AMPSKLDKLQAARIAALPLRNEKGYYEEADAPLASSAELSNFIRDRGAAWSQHRQRQQQR
RQQQQRQQPRSKPRR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaattcactctccaggatcgagcacatcgtccatctgatgctcgaaaaccgctcg
ttcgatcagatgctcggctttctctacaccgacgacggcaatcgctctcccaccgggcag
ccgttcgacggcctcaccggcaacgaatcgaatccggacgacctcggccgcccggtcggc
gtctaccggatccgcgccaccgatccgcatccgtatctgatgcccggcgccgatcccggc
gaaggctttcagaacaccaactatcaactgttctgcgacgaccaccccgcccccggcgcc
gtgccgaccaatcagggcttcgtcgtcaacttcaagtcggcgatcgcgaccgatcagtcg
cggcacgacaaggacgcgctgcccggcacgacgcccgagcagatcatgggcatgtacacg
ccggagctgctgcccgtgctgtccgggctcgcgaagggctatgcggtgtgcgaccgctgg
ttcgcgtctgcgccgacgatgacgatgcccaaccgcgcgttcgcgctcgccgccacgtcg
cagggccacctcgacgatcacgtgaagatcttcacttgcccgagcatcttcgggcggttg
tcggaccagggcgtcgactgggcgatcttcggctacaaccgcgatccgctcacgcgccac
gacttccccgacacgcagaacgccgacgacagccacttcggccactttcgcgatttccag
gcgcgcgcggcgagcggcacgctgcccgcgttcacgttcctcgaaccgagctgggatgcg
agcggcaacagccagcatccgaactacgacgtcgccgcgggcgagcaactgattcacgac
gtctactacgcgctgcgcaacggccccggctggaatagcacgctcttcatcgtcacgtac
gacgagcacggcggcaactacgatcacgtcgcgccgccgtccggcgcgacgccgcccggc
gacggcaccgtcggcgaattcggcttcgacttcacgcgcttcggcgtgcgcgtgcccgcg
gtgctcgtctcgccgctgatcgcggcgggcaccgtgtttcgcagcgcggcgggcacgatc
gatcacacgtcggtgctgaagacgatcggcgagcgcttcgggacggcgccgctgacggcg
cgcgaccgcgccgcgccgtcgctcggcgacgcgctcacgctcgcgagcccgcgcgccgcg
agcgacgatccgctcgccggcgtgaccgtacccgtgtcgcgcgtgtcccatccgaacgcg
gcgatgccgtcgaagctcgacaagctccaggcggcccgcatcgcggcactgccgctgcgc
aacgagaagggttattacgaggaagccgacgcgccgctcgcatcgagcgccgaactgtcg
aacttcattcgggaccgcggcgccgcgtggagccagcatcgccagcggcaacagcaacgg
cggcagcaacagcagcgacaacagccgcggagcaagccgcgccgctga

DBGET integrated database retrieval system