KEGG   Burkholderia pseudomallei MSHR520: BBX_1Help
Entry
BBX_1             CDS       T03163                                 

Definition
(GenBank) thiolase, C-terminal domain protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpsd  Burkholderia pseudomallei MSHR520
Pathway
bpsd00071  Fatty acid degradation
bpsd00072  Synthesis and degradation of ketone bodies
bpsd00280  Valine, leucine and isoleucine degradation
bpsd00310  Lysine degradation
bpsd00362  Benzoate degradation
bpsd00380  Tryptophan metabolism
bpsd00620  Pyruvate metabolism
bpsd00630  Glyoxylate and dicarboxylate metabolism
bpsd00640  Propanoate metabolism
bpsd00650  Butanoate metabolism
bpsd00900  Terpenoid backbone biosynthesis
bpsd01100  Metabolic pathways
bpsd01110  Biosynthesis of secondary metabolites
bpsd01120  Microbial metabolism in diverse environments
bpsd01130  Biosynthesis of antibiotics
bpsd01200  Carbon metabolism
bpsd01212  Fatty acid metabolism
bpsd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBX_1
   00630 Glyoxylate and dicarboxylate metabolism
    BBX_1
   00640 Propanoate metabolism
    BBX_1
   00650 Butanoate metabolism
    BBX_1
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBX_1
   00072 Synthesis and degradation of ketone bodies
    BBX_1
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBX_1
   00310 Lysine degradation
    BBX_1
   00380 Tryptophan metabolism
    BBX_1
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBX_1
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBX_1
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBX_1
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpsd04147]
    BBX_1
Enzymes [BR:bpsd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBX_1
Exosome [BR:bpsd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBX_1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHK64039
Position
1:30..437
Genome map
AA seq 135 aa AA seqDB search
MMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGAIRRLFEKNGWRAAEVDLYEINE
AFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGARILVTLIGALRARGAKRGVASL
CIGGGEATAMGIELI
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgcgtcgacggcgaaccggctcgggctcgcgccgctcgcgcgcgtcgtcggc
cattcgacgttcgcgcaggcgccgtcgaagttcacgacggcgcctgtcggcgcgatccgg
cgcctgttcgagaagaacggctggcgcgcggccgaggtcgacctgtacgaaatcaacgaa
gcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgagaaggtc
aacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcccgcatc
ctcgtcacgctgatcggcgcgctgcgcgcgcgcggggccaagcgcggcgtggcgagcctg
tgcatcggcggcggcgaggcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system