KEGG   Burkholderia pseudomallei MSHR520: BBX_1224Help
Entry
BBX_1224          CDS       T03163                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bpsd  Burkholderia pseudomallei MSHR520
Pathway
bpsd00860  Porphyrin and chlorophyll metabolism
bpsd01100  Metabolic pathways
bpsd01110  Biosynthesis of secondary metabolites
bpsd01120  Microbial metabolism in diverse environments
Module
bpsd_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bpsd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBX_1224 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpsd01007]
    BBX_1224 (hemL)
Enzymes [BR:bpsd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BBX_1224 (hemL)
Amino acid related enzymes [BR:bpsd01007]
 Aminotransferase (transaminase)
  Class III
   BBX_1224 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 PATR
Motif
Other DBs
NCBI-ProteinID: AHK65462
Position
1:complement(1332449..1333732)
Genome map
AA seq 427 aa AA seqDB search
MSNNQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWG
PMIVGHVHPDVLAAVQRVLADGFSFGAPTEAEIEIAEEICKLVPSIEQVRMVSSGTEATM
SALRLARGFTGRSRIVKFEGCYHGHADSLLVKAGSGLLTFGNPTSAGVPADVAKHTTVLE
YNNVAALEEAFAAFGGEIAAVIVEPVAGNMNLVRGTPEFLNALRALTAKHGAVLIFDEVM
CGFRVALGGAQQHYGITPDLTCLGKVIGGGMPAAAFGGRGDIMSHLAPLGGVYQAGTLSG
NPVAVAAGLATLRLIQAPGFHDALADKTRRLADGLAAEARAAGVPFSADAIGGMFGLYFT
EQVPASFADVTKSDIERFNRFFHLMLDAGVYFAPSAYEAGFVSSAHDDATLDATLDAARR
AFAALRA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaatcaaactctcttcgaacgcgcccagcgaaccatcccgggcggcgtcaat
tcgccggtgcgggcgttccgctcggtcggcggcacgccgcgcttcgtcgcgcgcgcgcag
ggcgcgtacttctgggacgcggacggcaagcgctacatcgactacatcggctcgtggggg
ccgatgatcgtcggccacgtgcacccggacgtgctcgcggccgtgcagcgcgtgctcgcc
gacggcttctcgttcggcgcgcccaccgaagccgaaatcgagatcgccgaggagatctgc
aagctcgtgccgtcgatcgagcaggtgcggatggtgtcgagcggcaccgaagcgacgatg
agcgcgctgcgcctcgcgcgcggcttcaccggccgcagccggatcgtcaagttcgagggc
tgctatcacggccatgcggacagcctgctcgtgaaggcgggctcgggcctgctcacgttc
ggcaatccgacctcggcgggcgtgccggccgacgtcgcgaagcacacgaccgtgctcgag
tacaacaacgtcgcggcgctcgaggaagcgttcgccgcgttcggcggcgagatcgccgcg
gtgatcgtcgagcccgtcgcgggcaacatgaacctcgtgcgcggcacgccggagttcctg
aacgcgctgcgcgcgctcaccgcgaagcacggcgccgtgctgatcttcgacgaagtgatg
tgcggctttcgcgtcgcgctcggcggcgcgcagcagcactacgggatcacgccggatctg
acctgcctcggcaaggtgatcggcggcggcatgccggccgccgcgttcggcggccgcggc
gacatcatgtcgcacctcgcgccgctcggcggcgtctatcaggcgggcaccctgtcgggc
aacccggtcgcggtcgcggcgggcctcgcgacgctgcggctgatccaggcgccgggcttt
cacgatgcgctcgccgacaagacccggcggctcgccgacggcctcgccgccgaggcgcgc
gcggcgggcgtgccgttctcggccgacgcgatcggcgggatgttcggcctctacttcacc
gagcaggtgcccgcgagcttcgccgacgtgacgaagagcgacatcgagcgcttcaaccgc
ttcttccatctgatgctcgacgccggcgtgtacttcgcgccctccgcgtacgaagcgggc
ttcgtgtcgagcgcgcacgacgacgcgacgctcgacgcgacgctcgacgccgcccgccgc
gcgttcgccgcgctgcgtgcctga

DBGET integrated database retrieval system