KEGG   Burkholderia pseudomallei MSHR520: BBX_185Help
Entry
BBX_185           CDS       T03163                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
bpsd  Burkholderia pseudomallei MSHR520
Pathway
bpsd00270  Cysteine and methionine metabolism
bpsd00920  Sulfur metabolism
bpsd01100  Metabolic pathways
bpsd01110  Biosynthesis of secondary metabolites
bpsd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpsd00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BBX_185 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BBX_185 (metX)
Enzymes [BR:bpsd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BBX_185 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     BBX_185 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: AHK64027
Position
1:199757..200902
Genome map
AA seq 381 aa AA seqDB search
MESIGVVAPHTMHFAEPLRLQSGSVLGNYQLVVETYGELNAARSNAVLVCHALNASHHVA
GVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTGPMSIDPATGTPYGARF
PVVTVEDWVHAQARVADAFGIERFAAVMGGSLGGMQALAWSLLYPERVAHCIDIASTPKL
SAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPRRGLRVARMIGHITYLSDDDMAEKFGR
ALRRADGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANTYLLITRALDYFDPAKAFNG
DLSAALAHTKAKYLIASFMTDWRFAPARSREIVKALLDNRRSVSYAEIDAPHGHDAFLLD
DARYHNLVRAYYERIAEEVGA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgatcggcgtcgtcgctccacacaccatgcatttcgccgaaccgctgcgcctg
caaagcggcagcgtgctcggcaactatcagctcgtcgtcgagacctacggcgagctcaac
gccgcgcgctcgaacgcggtgctcgtctgtcacgcgctcaacgcgtcacatcacgtcgcg
ggcgtctacgcggacgatccgcgcagcaccggctggtgggacaacatggtcgggcccggc
aagccgctcgacacgaaccgcttcttcgtgatcggcgtgaacaatctcggctcgtgtttc
ggctcgacggggccgatgagcatcgatcccgcaacgggcacgccgtacggcgcgcgcttt
ccggtcgtgacggtcgaggattgggtgcatgcgcaggcgcgcgtcgccgacgcgttcggc
atcgaacgcttcgccgcggtgatgggcggcagcctcggcgggatgcaggcgctcgcgtgg
agcctgctgtatccggagcgggtcgcgcactgcatcgacatcgcgtcgacgcccaagctc
tccgcgcagaacatcgcgttcaacgaagtcgcgcgctcggcgatcctgtcggaccccgat
ttccacggcggcgactactacgcgcacggcgtgaagccgcggcgcggcctgcgcgtcgcg
cggatgatcggccacatcacgtatctgtcggacgacgacatggccgagaaattcggccgc
gcgctgcgccgcgcggacggcgcgctcgacgcgtacaacttcaatttcgacgtcgagttc
gaagtcgagtcgtacctgcgctaccagggcgacaagttcgccgactacttcgacgcgaac
acgtacctgctgatcacccgcgcgctcgattacttcgatccggcgaaggcgttcaacggc
gacctgagcgcggcgctcgcgcatacgaaggcgaagtatctgatcgcgagcttcatgacc
gactggcgcttcgctcccgcgcgttcgcgcgagatcgtgaaggcgctgctcgacaaccgg
cgctcggtatcgtacgcggagatcgacgcgccgcacgggcacgacgcgttcctgctcgac
gacgcgcgctaccacaacctggtgcgcgcctattacgaacggattgccgaggaggtgggc
gcatga

DBGET integrated database retrieval system