KEGG   Burkholderia pseudomallei MSHR520: BBX_2960Help
Entry
BBX_2960          CDS       T03163                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpsd  Burkholderia pseudomallei MSHR520
Pathway
bpsd00010  Glycolysis / Gluconeogenesis
bpsd00053  Ascorbate and aldarate metabolism
bpsd00071  Fatty acid degradation
bpsd00280  Valine, leucine and isoleucine degradation
bpsd00310  Lysine degradation
bpsd00330  Arginine and proline metabolism
bpsd00340  Histidine metabolism
bpsd00380  Tryptophan metabolism
bpsd00410  beta-Alanine metabolism
bpsd00561  Glycerolipid metabolism
bpsd00620  Pyruvate metabolism
bpsd00625  Chloroalkane and chloroalkene degradation
bpsd00903  Limonene and pinene degradation
bpsd01100  Metabolic pathways
bpsd01110  Biosynthesis of secondary metabolites
bpsd01120  Microbial metabolism in diverse environments
bpsd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBX_2960
   00053 Ascorbate and aldarate metabolism
    BBX_2960
   00620 Pyruvate metabolism
    BBX_2960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBX_2960
   00561 Glycerolipid metabolism
    BBX_2960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBX_2960
   00310 Lysine degradation
    BBX_2960
   00330 Arginine and proline metabolism
    BBX_2960
   00340 Histidine metabolism
    BBX_2960
   00380 Tryptophan metabolism
    BBX_2960
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBX_2960
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBX_2960
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBX_2960
Enzymes [BR:bpsd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BBX_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LPD7 DUF1487
Motif
Other DBs
NCBI-ProteinID: AHK66841
Position
1:3353812..3355251
Genome map
AA seq 479 aa AA seqDB search
MEEAKHFIAGAWAPPAGGETIAVIDPSDGEPFARLARGTAPDVGAAVQAARAAFDGPWGA
LGAADRGRMLYRLSMLVAACREELALIESRDTGKPLTQARADADALARYLEFYAGAADKL
HGETLPYRDGYTVLTLREPHGVTGHIVPWNYPMQILGRSVGAALAAGNACVVKPSEDACL
SILRVATLAAEAGLPEGAFNVVTGYGHEAGAALARHPGVDHLSFTGSPDTGRLVAQMAAE
HHASVTLELGGKSPQIVFADADLDAALPVLVSAIVQNAGQTCSAGSRVLIDKAVYEPLVE
RLATAFNGLKVGPGRADLDCGPLINAKQQQRVWDFLSDAQHDGITMAAHGQVVPDAPETG
FYQAPALLRDVPHTHRLAQEEVFGPVLAAMPFADEDEALALANGTPFGLVAGIWTRDGAR
QMRLARKVRAGQVFVNNYGAGGGVELPFGGTGRSGYGREKGFEALYGFTVLKTIALRHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcgaagcacttcatcgcgggcgcatgggcgccgcccgcgggcggcgagacg
atcgccgtgatcgacccgtccgacggcgagccgttcgcgcggctcgcgcgcggcaccgcg
cccgatgtcggcgcggccgtgcaagcggcgcgcgccgcgttcgacggcccgtggggcgcg
ctcggcgcggccgaccgcgggcgcatgctgtaccggctgtcgatgctcgtcgccgcgtgc
cgcgaggagctcgcgctcatcgaatcgcgcgacaccggcaagccgctcacgcaggcgcgc
gcggacgccgacgcgctcgcccgctacctcgagttctacgcgggcgcggccgacaagctg
cacggcgagacgctgccctaccgcgacggctacacggtactcacgctgcgcgagccgcac
ggcgtgacgggccacatcgtgccgtggaattacccgatgcagatcctcgggcgcagcgtc
ggcgcggcgctcgccgcgggcaacgcgtgcgtcgtcaagccctcggaggacgcgtgcctg
tcgatcctgcgcgtcgccacgctcgccgccgaagccgggctgcccgagggcgcgttcaac
gtcgtgacgggctacggccacgaagcgggcgcggcgctcgcgcgccatcccggcgtcgat
cacctgtcgttcaccggttcgccggatacaggccgcctcgtcgcgcagatggcggccgag
caccacgcgagcgtcacgctcgagctcggcggcaagtcgccgcagatcgtgttcgccgac
gcggacctcgacgcggcattgcccgtcctcgtgtccgcgatcgtccagaacgccggccag
acctgttcggccggcagccgcgtgctgatcgacaaggcggtctacgagccgctcgtcgag
cggctcgcgaccgcgttcaacgggctgaaggtcggccccggccgcgccgatctcgattgc
gggccgctcatcaacgcgaagcagcagcagcgcgtgtgggacttcctctccgatgcgcag
cacgacggcatcacgatggccgcgcacggccaggtcgtgccggacgcgcccgaaacgggc
ttctaccaggcgcccgcgctgcttcgcgacgtgccgcacacgcaccggctcgcacaggag
gaagtgttcgggccggtgctcgccgcgatgccgttcgccgacgaggacgaagcgctcgcg
ctcgcgaacggcacgccgttcgggctcgtcgccggcatctggacgcgcgacggcgcgcgg
cagatgcggctcgcgcgcaaggtgcgcgcggggcaggtgttcgtcaacaactacggcgcg
ggcggcggcgtcgagttgccgttcggcggtaccgggcgctcgggctacggccgcgagaag
ggctttgaggcgctgtacggcttcaccgtgctgaagacgatcgcgctgcggcacggctga

DBGET integrated database retrieval system