KEGG   Burkholderia pseudomallei MSHR520: BBX_377Help
Entry
BBX_377           CDS       T03163                                 

Gene name
pheC
Definition
(GenBank) cyclohexadienyl dehydratase
  KO
K01713  cyclohexadienyl dehydratase [EC:4.2.1.51 4.2.1.91]
Organism
bpsd  Burkholderia pseudomallei MSHR520
Pathway
bpsd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpsd01100  Metabolic pathways
bpsd01110  Biosynthesis of secondary metabolites
bpsd01130  Biosynthesis of antibiotics
bpsd01230  Biosynthesis of amino acids
Module
bpsd_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:bpsd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBX_377 (pheC)
Enzymes [BR:bpsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     BBX_377 (pheC)
    4.2.1.91  arogenate dehydratase
     BBX_377 (pheC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AHK65661
Position
1:complement(410196..410981)
Genome map
AA seq 261 aa AA seqDB search
MKMNQTLLALACCAGLAHAQTAPQPGAPASRLDDVLARGTLRVCTTGDYKPYTYRREDGA
FEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGGISTTLERQKRVFFTQP
YVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFAKQHFTRAKLTVFPDNVT
IFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFGEKAYMVPRGDVVFQQYVD
QWLHLARETGELRAISDKWLK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaaccagacgttgctcgcgctcgcctgctgcgcggggctcgcccatgcacaa
accgcgccgcagccgggcgcgcccgcgtcgcggctcgacgacgtgctcgcgcgcggcacg
ctgcgcgtatgcacgacgggcgactacaagccgtacacgtaccggcgcgaggacggcgcg
ttcgaaggcatcgacatcgacatggcggcctcgctcgcgaaatcgctcggcgtgaagacg
gcgttcgtgaagaccacatggccgaccctcaccgatgatttcgtcgcgaagtgcgacatc
gcggtgggcggcatctcgacgacgctcgaacggcagaagcgcgtgttcttcacgcagcca
tacgtgagcgacggcaagacgccgatcgtgcgctgcgcggatgccgagcgctatcagacg
atcgcgcagatcgaccagccgcaaacgcgcgtgatcgtgaatccgggcggcacgaacgag
cgttttgcgaagcagcatttcacccgcgcgaagctcaccgtgtttccggacaacgtgacg
atcttcaagcagattctcgcgggaaatgccgacgtgatggtcacggacgcgtccgagacg
ctgctgcagcaaaagctgaatcccggcctgtgctcggtgcacccggacaagccgttccag
ttcggcgagaaggcgtacatggtgccgcgcggggacgtcgtgttccagcagtacgtcgac
cagtggctgcatctcgcacgcgagacgggcgagctgcgggcgatctcggacaagtggctc
aagtag

DBGET integrated database retrieval system