KEGG   Burkholderia pseudomallei MSHR305: BDL_1484Help
Entry
BDL_1484          CDS       T02756                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00520  Amino sugar and nucleotide sugar metabolism
bpse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BDL_1484 (nagA)
Enzymes [BR:bpse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BDL_1484 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGR73023
Position
2:complement(1798031..1799134)
Genome map
AA seq 367 aa AA seqDB search
MLTGNILTAEGWIHGTLEFENGRITTLSGDAADPSNNDAPYILPGFIDLHVHGAGGADVM
EGGDAIETIARTHARYGTTSLLATTMTAPRDELMRVVAELGDVARTRTPGGSRVLGVHLE
GPYINPGKLGAQPDAAVSAALDEVLKYLSIAPIRVVTLAPEIAGHIEIISEMAARGVRVQ
LGHSLGTYDDAVAALKHGACGFTHLFNAMSPLHHRNPGIVGAALAHAEYAEIIPDLLHVH
PGAIRAALRAIPRLYVVTDSTSATGMPDGEYRLGSQRVTKCLGGVRLADGTLAGSTLTMD
QALRNLVSLGLPIADVSSRMSRYAADYLGLADRGRIARGAWADLAVFDRELNLTATFVEG
ESIVEYA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccggaaacatactgaccgccgaaggctggatccacggcacgctcgaattcgag
aacggccggatcaccacgctgtcgggcgacgcggcggacccgtcgaacaacgatgcgccc
tacatcctgcccggcttcatcgatctgcacgtgcacggcgcgggcggcgcggacgtgatg
gaaggcggcgacgcgatcgagacgatcgcgcgcacgcacgcgcgctacggcacgacgagc
ctgctcgcgacgacgatgaccgcgccgcgcgacgagctgatgcgcgtcgtcgcggagctg
ggcgacgtcgcgcgcacgcgcacgccgggcggctcgcgcgtgctcggcgtgcatctcgaa
ggcccgtacatcaatcccggcaagctcggcgcgcagccggacgcggcggtgtccgcggcg
ctcgacgaggtgctgaagtatctgtcgatcgcgccgatccgcgtggtcacgctcgcgccg
gagatcgccgggcacatcgagatcatctcggagatggccgcgcgcggcgtgcgcgtgcag
ctcggccattcgctcggcacgtacgacgacgcggtcgccgcgctcaagcacggcgcgtgc
ggcttcacgcacctgttcaacgcgatgtcgccgctgcatcaccgcaatcccggcatcgtc
ggcgcggcgctcgcgcacgccgaatacgcggagatcatccccgatctgctgcacgtgcac
ccgggcgcgatccgcgcggcgctgcgcgcgatcccgcggctgtacgtggtgaccgacagc
acgtcggccaccggcatgcccgacggcgaataccggctcggcagccagcgcgtgacgaag
tgcctgggcggcgtgcgcctcgccgacggcacgctcgccggcagcacgctgacgatggat
caggcgctgcgcaatctcgtgtcgctcggcctgccgatcgccgacgtgtcgagccggatg
tcgcgctacgcggccgactatctcgggctcgccgatcgcggccgcatcgcgcgtggcgcg
tgggccgatctcgccgtgttcgaccgcgagctgaatctgaccgcaaccttcgtcgaagga
gaatcgattgtcgaatatgcttaa

DBGET integrated database retrieval system