KEGG   Burkholderia pseudomallei MSHR305: BDL_1953Help
Entry
BDL_1953          CDS       T02756                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00360  Phenylalanine metabolism
bpse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpse00790  Folate biosynthesis
bpse01100  Metabolic pathways
bpse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BDL_1953 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDL_1953 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BDL_1953 (phhA)
Enzymes [BR:bpse01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BDL_1953 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AGR73486
Position
2:complement(2311150..2312043)
Genome map
AA seq 297 aa AA seqDB search
MSTVVTAKLKEQFDAGLETRADFTIDQPLARYGDVDHAVWTQLYTRQAALLRGRACDAFI
EGLARIGLAPDRVPSFADVNRRLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGRAALRVADDASALALLARLYWYTV
EFGLIRDTRGENGLRIYGAGIVSSKGETLYSLESASPNRIGFDLERVMRTRYRIDTFQKT
YFVIDDFAQLFALADLDARALAARLAGAPEHAAGAVLDGDHVLTRGTGEGWAANADA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccacggtcgttaccgcgaaactgaaggaacagttcgacgcgggcctcgaaacccgc
gccgatttcaccatcgatcagccgctcgcccgttacggcgacgtcgaccacgcggtgtgg
acgcagttgtatacgcggcaggcggcgctgctgcgcggccgtgcatgcgacgcgttcatc
gagggcctcgcgcgcatcggcctcgcgcccgatcgcgtgccgtcgttcgccgacgtgaac
cggcggctcgagcccgcaaccggctggcgcatcgtcgcggtgccgggcctcgtgccggac
gccgttttcttcgagcatctcgcgaaccggcggtttccggtcacctggtggatgcgccgc
ccggaccagctcgattatctacaggagccggactgcttccacgatctgttcggccacgtg
ccgctgctgatcgatcccgtattcgccgactacatgcacgcatacggccgcgcggcgctt
cgcgtcgccgacgacgcaagcgcgctcgcgctccttgcgcgcctctattggtatacggtc
gaattcggcctgattcgcgacacgcgcggcgaaaacgggctgcggatctacggcgcgggc
atcgtgtcgagcaagggcgaaacgctctacagcctcgaaagcgcgtcgccgaaccggatc
ggcttcgatctcgaacgcgtgatgcggacccggtaccggatcgacacgttccagaagacc
tacttcgtgatcgacgatttcgcgcaactcttcgcgctcgccgacctcgacgcgcgcgcg
ctcgccgcgcggctcgccggcgcgcccgagcacgcggcgggcgcggtgcttgacggcgat
catgttctcacgcgcggcaccggtgaaggctgggcagccaatgcagacgcttga

DBGET integrated database retrieval system