KEGG   Burkholderia pseudomallei MSHR305: BDL_2301Help
Entry
BDL_2301          CDS       T02756                                 

Definition
(GenBank) type VI secretion lipofamily protein
  KO
K11906  type VI secretion system protein VasD
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDL_2301
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_2301
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: AGR73514
Position
2:complement(2677233..2677847)
Genome map
AA seq 204 aa AA seqDB search
MNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTL
YAAQNLNAANDNRPLALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITL
IPGQHYNATEKVSREAQAFGVVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTG
GTVIPSQQGMPTQRLDLLSSVNCG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcatgtgactcgttacgcgctgccgctcgccgcctgcattctgctcggcggc
tgcgcggccgccgtgccgctcctcggttcggcgggcagcgccgcgctgcagatggtgggc
gtcggcaaacccgacgtgcccgattcgcagaagccgccgcgcaatctcggcctcacgctc
tatgcggcacagaacctcaacgccgcgaacgacaaccgtccgctcgcgctcgtcgtgcgc
ctctacgcgctgaaagatccgacgtcgttccagcaggcgccgttcgacagcttcaccgat
ccgacgaaagaaaagaccgcgctcggcgccgatctgctgagcgtacgcgaaatcacgctg
attccggggcagcactacaacgcgaccgaaaaggtgtcgcgcgaagcgcaggcattcggc
gtcgtcgcgctttttcgcgatccggcgctacaacgctggaaactaactttcgatccggcg
aaatccgagaaatccggcataatcattggcctgcacaactgcgcgatgaccgtgacgggc
ggcaccgtcatcccttcgcagcaaggcatgccgacgcagcggctcgatttgctgtcgtcg
gtgaactgcgggtga

DBGET integrated database retrieval system