KEGG   Burkholderia pseudomallei MSHR305: BDL_234Help
Entry
BDL_234           CDS       T02756                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00260  Glycine, serine and threonine metabolism
bpse01100  Metabolic pathways
bpse01110  Biosynthesis of secondary metabolites
bpse01120  Microbial metabolism in diverse environments
bpse01130  Biosynthesis of antibiotics
bpse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDL_234 (ltaA)
Enzymes [BR:bpse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BDL_234 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGR70577
Position
2:complement(295727..296797)
Genome map
AA seq 356 aa AA seqDB search
MIDFLSDTVTLPTAEMRHAMFTANVGDDCYGEDPTVNELESVAAGLTGKEAAAFVTSGTL
GNLSALLAQCPRGHEVILGDRSDLYNYEAGGVSLVGGAVLHPVETADDGSLPLERLRAAI
RDKRDPQCAPAAVIALENPHCLAGGRVLSLDYLRRVRALADEHGLAVHMDGARLFNAQAS
LGTPAAEIVAHVDSVQFCLSKSLAAPYGSMVCGSAALIDRVKRYRKLLGGGTRQAGIMAA
AGLVALRTMVARLADDHRRAARLAAELARIPGVALRSAVIETNMVFFDVAEPGNEAFLAA
LRDAGIRMGVLGDGVIRAVVHYMIDDDAISRTVDAVRAIVLPFAPALAPAAASQAQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttcctgagcgacacggtgacgctgccgaccgcggagatgcggcacgcgatg
tttaccgcgaatgtgggcgacgattgctatggcgaggatccgacggtcaacgagctcgaa
tcggtggcggccggactgaccggcaaggaagcggcggcgttcgtcacgagcggcacgctc
ggcaacctgagcgcgctgctcgcgcaatgcccgcgcgggcacgaggtgatcctcggcgat
cgctccgacctgtacaactacgaggcgggcggcgtgtcgctcgtcggcggcgcggtgttg
caccccgtcgagaccgccgacgacggcagcctgccgctcgagcggctgcgcgcggcgatc
cgcgacaagcgcgacccccagtgcgcgcccgccgcggtgatcgcgctcgagaatccgcat
tgcctcgccggcggccgcgtgctgtcgctcgactacctgcggcgcgtgcgcgcgctcgcc
gacgagcacgggctcgccgtgcacatggacggcgcgcgtctgttcaacgcgcaggcgagc
ctcggcacgccggcggccgagatcgtcgcgcacgtcgattcggtccagttctgcctgtcg
aagagcctcgccgcgccgtacggctcgatggtgtgcggcagcgccgccctgatcgatcgc
gtgaagcgctatcggaagctgctcggcggcggcacgcggcaagccggcatcatggcggcc
gccgggctcgtcgcgctgcgcacgatggtcgcgcggctcgcggacgatcaccgccgcgcg
gcgcgcctcgccgcggagctggcgcggattccgggcgtcgcgctgcgctcggcggtgatc
gagacgaacatggtgttcttcgacgtcgccgagccgggcaacgaggcgtttctcgccgcg
ctgcgcgacgcgggcatccggatgggcgtgctcggcgacggcgtgatccgggccgtcgtg
cactacatgatcgacgacgacgcgatcagccgcaccgtcgacgccgtccgcgcgattgtt
cttccgttcgccccggcgttagcgccggccgccgcatcgcaggcgcaatga

DBGET integrated database retrieval system