KEGG   Burkholderia pseudomallei MSHR305: BDL_3740Help
Entry
BDL_3740          CDS       T02756                                 

Definition
(GenBank) succinate CoA transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00020  Citrate cycle (TCA cycle)
bpse00620  Pyruvate metabolism
bpse00650  Butanoate metabolism
bpse01100  Metabolic pathways
bpse01110  Biosynthesis of secondary metabolites
bpse01120  Microbial metabolism in diverse environments
bpse01130  Biosynthesis of antibiotics
bpse01200  Carbon metabolism
Module
bpse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDL_3740
   00620 Pyruvate metabolism
    BDL_3740
   00650 Butanoate metabolism
    BDL_3740
Enzymes [BR:bpse01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BDL_3740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AGR69391
Position
1:263342..264856
Genome map
AA seq 504 aa AA seqDB search
MPTSRILAPSLRSLVRTADEAAALIGPNMTVAMSGFTGSGYPKAVPAALAARIAASHARG
EDFRINVLTGASTAPELDGALAKADGISMRLPYQSDPTLREKINAGELDYQDIHLSHVAQ
YAWFGLFGELDVAIVEVAGIREDGRLIPSASVGNNKTWLDQAKRVILEVNARQPLGLDGM
HDIYYGTALPPNRKPIPLVKSDDRIGEPYLRCPAEKIVAIVETDAPDRSNAFAAPDETSK
QIAGLLIDFLRHEIKRGRLPEHLLPLQSGVGNITNAVLAGLGEGGFSNLSAYTEVIQDGM
LDLLANGTLSFASATALSLSPDAVKRFADEIDTFRSKIVLRPQEISNHPELVRRLGIIAM
NGMIEADIYGNVNSTHVMGTRIQNGIGGSGDFARNGYLSCFMSASTAKGGAISRIVPMAS
HVDHTEHDVAVVVTEQGLADLRGLSPKQRARKVIANCAHPDYRPMLEDYFERASRESFGK
QTPHLLGEALSWHERYVRTGSMKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccaacttctcgtatcctcgcccccagcctgcgctccctcgttcgcaccgccgacgag
gccgccgcgctgatcggcccgaacatgaccgtcgcgatgagcggcttcaccggctccggc
tatccgaaggcggtgccggccgcgctcgccgcgcggatcgcggcttcccacgcgcgcggc
gaagatttccgcatcaacgtgctgacgggcgcgtcgaccgcgcccgagctggacggcgcg
ctcgcgaaggcggacggtatctcgatgcggctgccgtaccagtccgatccgacgctgcgc
gagaagatcaacgcgggcgagctcgactatcaggacatccacctgagccacgtcgcgcag
tacgcgtggttcggcttgttcggcgagctggacgtcgcgatcgtcgaggtcgcgggcatt
cgcgaggacgggcgcctgattccgtcggcgtcggtcggcaacaacaagacgtggctcgac
caggccaagcgcgtgatcctcgaggtgaacgcgcgccagccgctcggtctcgacgggatg
cacgacatctattacggcaccgcgctgccgccgaaccgcaagccgattccgctcgtgaag
agcgacgaccggatcggcgagccgtatctgcgctgcccggccgagaagatcgtcgcgatc
gtcgagaccgacgcgccggaccgcagcaacgcgttcgccgcgccggacgagacctccaag
cagatcgccggactcctgatcgatttcctgcgtcacgagatcaagcgcggccgtctgccc
gaacacctgctgccgctgcagtccggcgtcggcaacatcacgaacgcggtgctcgccggc
ctcggcgaaggcggtttctcgaacctgagcgcgtatacggaagtgattcaggacggcatg
ctcgatctgctcgcgaacggtacgctgagcttcgcgtcggcgaccgcgctgtcgctcagt
ccggatgcggtgaagcgcttcgccgacgagatcgatacgttccgctcgaagatcgtgctg
cggccgcaggaaatcagcaaccatccggagctcgtgcggcgcctgggcatcatcgcgatg
aacgggatgatcgaggccgatatctacggcaacgtgaactcgacgcacgtgatgggcacg
aggattcagaacgggatcggcggctccggcgatttcgcgcgcaacggctatctgtcgtgc
ttcatgtcggcgagcaccgccaagggcggcgcgatttcgcggatcgtgccgatggcaagc
cacgttgaccataccgagcacgacgtcgcggtcgtcgtgaccgagcaggggctcgcggat
ctgcgtggactgtcgccgaagcagcgcgcgcgcaaggtcatcgcgaactgcgcgcatccc
gattaccggccgatgctcgaagactacttcgagcgcgcgagccgcgagagcttcggcaag
cagacgccgcatctgctcggcgaagcgctgtcgtggcacgagcgctacgtgcggaccgga
tcgatgaaagcctga

DBGET integrated database retrieval system