KEGG   Burkholderia pseudomallei MSHR305: BDL_3747
Entry
BDL_3747          CDS       T02756                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bpse  Burkholderia pseudomallei MSHR305
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_3747
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_3747
SSDB
Motif
Pfam: T6SS_TssF FbpC_C_terminal
Other DBs
NCBI-ProteinID: AGR67980
Position
1:270790..272652
AA seq 620 aa
MNFLDHYNDELRQLRDAGARFSKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQK
RLDRECAEFAQQALGRICPLYTASTPAISTFAFHPDLGSPDAFRGNTLPRGSLIAAHLPG
RKLPVMFSTAREVTLLPLRLASVECSRSITGLPSLLAQRLASSHAVLRFRFEIEGGASIA
ELAREDDGFKPLHLSVAGDLPRAYALHRALLADTTAWYALVSTNRGDEVLPLPMSGIRLS
GVDDEEALLPEAFGGLPGLRLLREYFAQPTRLLGVYVDALAAIAAKAPSARAFDLFFALR
DAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMRPAAHHLWALT
EVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLEPDDVATITGRALVADRDWRPSALLDAELQLLDPTAVKRIECLWPASAPRGK
PSIDACWEAVSHVGRNPLALRASQQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVVLR
SRFVAAGRATPTALVRATQVEIDIAESLHADRGGWLFGRLLAQALAEAATLNDGIEIVVR
LDGEAASTHTNVATRDGRLA
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacttcctcgatcactacaacgacgaattgcgccagttgcgcgatgcgggcgcacgc
ttctccaaggagcacccgcaggtggcctccgcgctcgggctgcatccggatgcggtcacc
gatccgttcgtcgagcgcctgctcgagggcgtcgcgtacctgtcggcgcgcgtgcagaag
cggctcgatcgcgagtgcgcggagttcgcgcagcaggcgctcgggcgcatctgcccgctc
tacacggcttccacgcccgcgatctcgacgttcgcgttccatcccgatctcggctcgccc
gatgcgtttcgcggcaacacgctgccgcgcggctcgctcatcgccgcgcacctgcccggg
cgcaagctgccggtgatgttctcgaccgcgcgcgaggtcacgctgctgccgctgcgtctc
gcatcggtcgagtgcagccgcagcatcaccgggctgccgtcgctgctcgcgcagcggctc
gcctcgtcgcacgcggtgctgcgcttcaggttcgagatcgagggcggcgcgtcgatcgcg
gagctcgcgcgcgaggacgacggcttcaagccgctgcatctgagcgtggcgggcgatctg
ccgcgcgcatatgcgctgcaccgcgcgctgctcgccgacaccaccgcgtggtacgcgctc
gtgtcgacgaaccgcggtgacgaggtgctgccgttgccgatgtcgggcatccggctgtcc
ggcgtcgacgacgaggaggcgctgctgcccgaggcgttcggcgggctgcccggcctgcgg
ctgctgcgcgagtacttcgcgcagcccacgcggctgctcggcgtctacgtcgacgcgctg
gcggcgatcgccgcgaaggcgccgtccgcgcgcgcgttcgatctgttcttcgcgttgcgc
gacgcgccgggcgatctggtgggcgacgtcgacgcgagccagttccgcctgttcgcgacg
ccggcgatcaatctgtattccaaacgtttcgacccggtgccgtacgacgcgaatcagccc
gagcagtggattcccgtcgaccggatgcggcccgccgcgcatcacctgtgggcgctcacc
gaggtgttcgtgtgcgagaccaacggtcgcgcgcaccgcgcgcgctcggtgctcgagacg
gcgggctacgaagggcacgaaggctcgatccgctacggcatgcggcgcgaggacgcgctg
ctcgtcgacggcgtgcggcgcgaccggttcgatccgctcgcgagccacgacctgatcgcc
gtctcgatggtcgacgacacgctcgagccggacgacgtcgcgacgatcacgggccgcgcg
ctcgtggccgatcgcgactggcgcccgagcgctctgctcgacgccgagctgcaactgctc
gatccgaccgcggtcaagcgcatcgagtgcctgtggccggcgagcgcgccgcgcggcaag
ccgagcatcgacgcgtgctgggaggcggtctcgcacgtcgggcgcaacccgctcgcgctg
cgcgcgtcgcagcagcaggacgtgacggcgcgcatcgtcgagcagttgctgctcgcgatc
gacaaggacgacgcgctcgatcgccagcggctcgagagcctgcgctcggtcgtgctgcgc
tcgcgcttcgtcgcggcggggcgcgccacgcccaccgcgctggtgcgcgcgacacaggtg
gagatcgacatcgccgaatcgctgcacgccgatcgcggcggctggctgttcgggcggctg
ctcgcgcaggcgctcgcggaggccgccacgctcaacgacggcatcgagatcgtggtgcgc
ctggacggcgaagcggcgagcacgcacacgaacgtcgccacgcgcgacgggaggctcgca
tga

DBGET integrated database retrieval system