KEGG   Burkholderia pseudomallei MSHR305: BDL_3748Help
Entry
BDL_3748          CDS       T02756                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bpse  Burkholderia pseudomallei MSHR305
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_3748
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_3748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG DUF3732 Cu_bind_CorA
Motif
Other DBs
NCBI-ProteinID: AGR68043
Position
1:272649..273638
Genome map
AA seq 329 aa AA seqDB search
MTPLERVSRALTPRRTFFELMRRVEALQRRHDGRSARKRRMPKWLRIEQPAQMHFASTEV
ERVQVTLARFVEDDDHPQVTVAQRHFGLFAPYGPLPLHVTEHAMQEKRFERNAAFERFVN
VACGDLAWLHYSAWSSMHPVLGYERARNPFVERVTALADACRAQQDDGEPYGRHALACRR
AFPGIYCAPRRSLADLQRLLRAYFGVALQVVPRHGRWVPVPAAASHARRLGGWRLGARIW
DVQHSIEIVVGPIEADEFYRWQRRAAAVMALSAVVTDFVDGRIYPVIKVQVWTRPELAGR
VGCMRVGVDAWSRPNRALRTLTVFESFRD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgctcgagcgcgtgagccgggcgctgacgccgcgccgcacgttcttcgagctg
atgcggcgcgtcgaggcgctgcagcgcaggcacgacgggcgttcggcgcgcaagcgccgg
atgccgaagtggctgcgcatcgagcagccggcgcagatgcacttcgcgagcacggaagtc
gagcgcgtgcaggtgacgctcgcgcgcttcgtcgaggacgacgatcacccgcaggtcacg
gtggcgcagcgccatttcgggctgttcgcgccgtacgggccgctgccgctgcacgtgacc
gagcacgcgatgcaggagaagcgcttcgagcgcaacgccgcgttcgagcgcttcgtaaac
gtcgcgtgcggcgatctcgcgtggctgcattactcggcgtggtcgtcgatgcatccggtg
ctcggctacgagcgcgcgcgcaatccgttcgtcgagcgcgtgacggcgctcgccgatgcg
tgccgcgcgcagcaggacgacggcgagccgtacgggcggcacgcgctcgcatgccggcgc
gcgtttccgggcatctactgcgcgccgcgccgctcgctggccgatctgcagcggctgctg
cgcgcgtacttcggcgtggcgctgcaggtcgtgccgcgccacgggcgctgggtgccggtg
ccggccgcggcgagccatgcgcggcggctcggcggctggcggctgggtgcgcggatctgg
gacgtgcagcactcgatcgagatcgtggtggggccgatcgaggcggacgagttctaccgg
tggcaacgccgcgcggccgccgtgatggcgctgtcggcggtcgtgacggatttcgtcgac
ggacggatttaccccgtcatcaaggttcaggtgtggacgcgccctgaactcgcaggaagg
gttgggtgcatgcgtgtcggggtcgacgcgtggtcacggccgaatcgggcgctgcgcacc
ttgactgtctttgaatcttttcgggactag

DBGET integrated database retrieval system