KEGG   Burkholderia pseudomallei MSHR305: BDL_3750Help
Entry
BDL_3750          CDS       T02756                                 

Definition
(GenBank) Rhs element Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDL_3750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_3750
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_3750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V
Motif
Other DBs
NCBI-ProteinID: AGR69995
Position
1:276502..278793
Genome map
AA seq 763 aa AA seqDB search
MRLIELRSPLLDPDAVALSFVVHESLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLG
EGDIRTFNTHVFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQ
GHQRNGYRFELEGTYEPREYCVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQ
RFEDLPLPNDTLEYLPDGEESRAIQGREGVQRLQRTRRIKSNNVALRDFDYHAPSNKLDS
DAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEAIQAESHTLVGEANARALATG
RAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQPFRPLLTTP
RPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGY
QNASQITFDDQRGAERVMIHAERDMQQTVERNSSTSIAQDLNLSVKGTSTSVVGISISFT
GISVSYTGLSVSFTGVSASFTGLSTSFTGVSTSFTGVSTSFTGVDTSFKGVSTSFTGVDT
SFKGVSTSFTGVSTSLTGSSNSVTGVSNSMTGISSSWTDVSMSTTGQSQSITGVSLSYTG
TSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTTGSSTSVTGSSVSTTGSSVS
TTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgatcgaactgcgcagtcccctgctggacccggatgcggtggcgctgagcttc
gtggtgcacgagagcttgtcgcaggagccgtcgtatcaactggatctgctgagccacgac
ccggatctggacttcgacgcgctgctcggctcgacgctgtcggccgacatcgacctgggc
gaaggcgacatccggacgttcaacacgcacgtgttcggcggctacgacacggggcagatg
agcgggcaatacacgtacacgctggagctgcgaagctggctgtcgtttctcgcggagaac
cgcaacagccggatcttccagaacatgagcgtgccgcagatcgtcgagcaggtgttccag
ggccatcagcgcaacggctaccggttcgagctcgaaggcacgtacgagccgcgcgagtac
tgcgtgcagtttcaggaaacggatctgaacttcgtgaagcggctgctggaggacgaaggg
atctacttctgggtggagcacgagccggatcgtcatgtggtggtgatctcggacacgcag
cggttcgaggatctaccgctgccgaacgacacgctggagtatctgccggacggcgaggag
tcgcgcgcgatccaggggcgcgaaggggtgcagcggctgcagcgcacgcggcggatcaag
tcgaacaacgtcgcgctgcgggatttcgactatcacgcgccgtcgaacaagctcgacagc
gacgcgcagcaggtgtcgccgccgaacctcgaagggattccgctcgagtattacgactat
gcggcgggctaccgcgagcccgagcagggcgagcgtctcgcgcggctgcggctcgaggcg
attcaggcggaatcacacacgctggtgggcgaggcgaacgcgcgcgcgctggccacgggc
cgggcgttcacgttgatcgggcatccggcgctggggcgcaatcgtcggtactacgtgacg
aacagcgagctgacgttcatccaggacggaccggacagcacgtcgcaggggcgcaacgtc
gcggtgaagttccgcgcgcttgccgacgatcagccgtttcggccgctgttgacgacgccg
cgtcccgaagtgccgggcatccagagcgcgacggtggtgggtccggagatgtcggaagtg
cataccgacaagctcgggcggattcgcgtgcatttccactgggaccgctacaagacgacc
gaggcggatgcgtcgtgctggatacgcgtgtcgcaggcatgggcgggcaagggctggggc
gtgatcgcgatgccgcgggtcgggcaggaagtgctcgtcacgtatgtcgacggcgatctc
gatcggccgctcgtgacgggcatcgtctacaacggcgagaacccgacgccttatgacttg
ccgaaggacatccgctacacggggctggtgtcgcgttcgatcaagcgtgcgggcggttat
cagaacgcgagtcagatcacgttcgatgaccagcgcggcgcggagcgcgtgatgatccac
gcggagcgcgacatgcagcagacggtcgagcgcaacagctcgacgtcgatcgcacaggat
ctgaacctgtcggtgaagggcacgtcgacgtcggtcgtcggcatctcgatcagcttcacg
ggcatctcggtgtcgtacacggggttgtcggtgagcttcaccggcgtgtcggcgagcttc
acgggcttgagcacgtcgtttaccggcgtgagcacgagtttcaccggcgtgtcgacgtcg
tttaccggcgtcgacaccagcttcaagggcgtgtcgacgtcgtttaccggtgtcgatacc
agcttcaagggtgtgtcgacttcgttcacgggcgtaagcacgagcctcaccggttcgagc
aactcggtgacgggcgtatcgaacagcatgacgggcatctcgtcatcatggaccgacgtc
agcatgtcgacgaccggccaatcccaaagcatcacgggggtatcgctgtcgtacacgggc
acgtcgaacagcatgacgggcacgagcacgtcggtgacgggcacctcgacgagcatcacc
ggcacgtcgatgtcgaacaccggcagctcgacgagcatcacgggcacgtcgatgtcgacg
acgggcagctcgacgagcgtcaccggctcgagcgtatcgacgaccggcagctcggtgagc
acgacgggctcgagcgtgtcgacaacgggcagcagcgtgtcgacgacgggtttcagcttc
tcgtacaccggcgtcagctattcggacaccggtatcgacctgaagaaggtcggcatgcaa
gtgaagagctga

DBGET integrated database retrieval system