KEGG   Burkholderia pseudomallei MSHR305: BDL_4812
Entry
BDL_4812          CDS       T02756                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bpse  Burkholderia pseudomallei MSHR305
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_4812
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_4812
SSDB
Motif
Pfam: T6SS_TssF HPIP
Other DBs
NCBI-ProteinID: AGR69680
Position
1:1654379..1656121
AA seq 580 aa
MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQ
KLDEGLPELVQALANLLFPHSLRPVPAATLIAFEPRGALRERAVIAAGTEIESVPVDGTA
CRFRTCGELDIEPIALAGCRFVPPAHGGPALRLDFEMLGLDASEWDATRIRLFIGGERLH
ASRLFALLMQHVVAVEIAGGPPELPGPRCALGARALRPAGFDDALLPCPERAFPGFRLLH
EYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPDWLPGIDRDSFRLNVAAALNL
FAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGYRPGHAVDRHYVPFGVAGDDA
NAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSIGLSCTNGALPARLKIGDVCRA
TDSSPERFTFANIAPVSPPLDPPLGEPLLWRTIGHLALNFLSLGDADHLKRMLALHAFGE
RGDDARAQADRRRIDGIESVDVRAETRIIGERMLSGQRVALRCSAHAFGGAGELYLFGCV
LERFLAEYAAINTYTRVEIDASPDGVRFAWPPRMGAQCLL
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggccaccaccacgcccaatcgctattacgaggacgagctcgttcgcctgcgcgagctc
gccgccgagttcgcccgcgcgcacccgctgctcgcgccgatgctcggcgcgccgtcgggc
gacccggacgtcgagcggctgctcgaaggcgtcgcgttcctgacggggctcgcgcggcaa
aagctcgacgaaggcctgccggagctcgtgcaggcgctcgcgaacctgctgtttccgcac
tcgctgcgcccggtgccggcggccacgctgatcgcgttcgagccgcgcggcgcgctgcgc
gagcgcgcggtgatcgcggccggcaccgagatcgaatcggtgcccgtcgacggcaccgcc
tgccggtttcgcacgtgcggcgagctggacatcgagccgatcgcgctcgccggctgccgg
ttcgtgccgcccgcgcacggcgggcccgcgctgcggctcgacttcgagatgctcggtctc
gacgcgagcgaatgggacgcgacgcgcattcgcctgttcatcggcggcgagcggctgcac
gcaagccgcctgttcgcgctgctgatgcagcacgtcgtagcggtcgagatcgcgggcggc
ccgcccgagctgcccggcccgcgctgcgcgctcggcgcccgcgcgctgcgcccggcgggc
ttcgacgacgcgctgctgccctgccccgagcgggcgttccccggcttccggctgctgcac
gaatatttcgcgttcgccgagaaattcctgttcgtcgagctgggcggcctcgagcgctgg
cgcgcggcgcgcgcgggcgcgcagttcagcgtatggctcgcgctcgacagcgcgcccgac
tggctgcccggcatcgatcgcgacagcttccggctgaacgtcgccgccgcgctgaacctg
ttcgcgcacgaagcggtgccgatccagcacgagcatcgcgcgaccgattaccggctgcag
cccgaaggcgacacgtcgggccactaccggatctactcggtcgaccgcgtgatcggctac
cgccccggccacgcggtcgaccgccattacgtgccgttcggcgtcgcgggcgacgacgcg
aacgccgcgagctaccggctgattcgccgcgccgcgctcgacggccacgggcaggatctc
catctggcgctcgcctacccgcccggcgaggcgctcgccacggaaacgctgtcgatcggc
ctgtcgtgcacgaacggcgcgttgcccgcgcgcctgaagatcggcgacgtgtgccgcgcg
accgacagctcgcccgagcgcttcacgttcgccaacatcgcgcccgtgagcccgccgctc
gatccgccgctcggcgaaccgctgctgtggcgcaccatcggccatctcgcgctgaacttc
ctgtcgctcggcgacgccgaccatctgaagcgcatgctcgcgctccacgcgttcggcgaa
cgcggcgacgacgcgcgcgcgcaagccgaccgccgccgcatcgacggcatcgaatcggtc
gacgtgcgtgccgagacgcggatcatcggcgagcggatgctgagcggccagcgcgtggcg
ctgcgctgcagcgcccatgcgttcggcggcgcgggcgagctgtatctgttcggctgcgtg
ctcgagcgctttctggccgaatacgcggcgatcaacacctacacgcgcgtcgagatcgac
gcgtcgcccgacggcgtgcgcttcgcgtggccgccgcggatgggggcgcaatgcctgctc
tag

DBGET integrated database retrieval system