KEGG   Burkholderia pseudomallei MSHR305: BDL_4815
Entry
BDL_4815          CDS       T02756                                 

Definition
(GenBank) Rhs element Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDL_4815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_4815
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_4815
SSDB
Motif
Pfam: Phage_GPD Phage_base_V LmeA
Other DBs
NCBI-ProteinID: AGR68258
Position
1:1660192..1663215
AA seq 1007 aa
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVS
RQSRIDFAKMLSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWR
LSLYKASDVYLNEQTIPNIVNRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVS
RWMEKEGLYYYFEHDGRHETLVIVDDRRHQPGPADDLALRYLPATSLDAGIEADRVQAFT
CRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVSSDEHFHTKDEGQRYAKLRAE
ALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQAHLLFPDLDAP
FGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAV
PNSSHRSVVTRRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLT
SGNKFDFSLGNAYSFSGGLKCSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGS
RSFEINDSASTLLQTLHKQSATGAIRLSAGQDASALLQKQLDKLKGTVRKFMIVSGLANA
GSAAAAAGLIKGGGKLANLPWAGFGISAAQFAGATGVSTALMATSRTLLANVAKLQEALP
LVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSVGKGRWGVEAA
KHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSA
VRMSASDAQLGFKGNRLVATADGVTLSHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAA
GCGSASLKLGSDGAIDVSATDVKLNGTNVKLNGSASLKFDGQLIQLG
NT seq 3024 nt   +upstreamnt  +downstreamnt
atgccttcgtccccccgccacgatgcgcccgcgtcgcgcgcgaacgccgcgccgtccgcg
aacgcgcgacgcttcacgttcgcgagcgacgcgtacgaccccgcgacgttcgacgtcgtc
gacatcaacggccgcgacgcgatctcgcagccgtaccggttcgagatcacgctcgtgagc
aggcagtcgcggatcgacttcgcgaagatgctgagccgcggggcgacgctcgcgatcctg
ccgccgttcggcgaggccggcaccacccgctatgccggcgtgctcgccgaattcgagcag
aagaaacgctttcgcgacttcaccgtctatcgcgcgacgctcgtgccgcgcctctggcga
ctatcgctgtacaaggcgtcggacgtctatctgaacgagcagacgattcccaacatcgtc
aatcgcgtgctgcgcgccgcctcgttcggcagccgcgatttccgcatgcggcacggcggc
ggctaccgcaagcgcagcttcgtctgccagtacgacgagagccatctcgatttcgtgtcg
cgctggatggagaaggaaggcctctactactacttcgagcatgacggccggcacgaaacg
ctcgtgatcgtcgacgaccgccgccatcagcccggccccgccgacgatctcgcgctgcgc
tacctacccgcgaccagcctcgacgcgggcatcgaagcggaccgcgtgcaggcgttcaca
tgccgggcgacgccgctgccgcgcgaagtcgtgctgcgcgatttcaaccaccgcaaggcg
gagctctcgctcgaagtccgcgagcgcgtggcgcgcgacggcgtcggcgagcgggtgtcg
agcgacgagcacttccacacgaaggacgaagggcagcgctacgcgaagctgcgcgccgag
gcgctcgtctgcgaagggcgccgattcgccggcgaatcgaccgcggccgggctgcgcgcc
ggccgcttcttcgcgctgtcgggccactaccgcgaggatttcgacggccgctatctggtg
acggcgctcacgcatcgcggctcgcaggcacacctgctgtttcccgatctcgacgcgccg
ttcggcgcgacgccgggcgagcccatctaccgcgccgagttcgaggcgattgccgccgac
ctccagtaccggccgccgcgcacgacgcccaagccgcgcgcggcgggcgtcgtcagcgcg
atcgtcgacggcgagggcggcggcaagctcgccgagctcgacgaatacggccagtacaag
gtgcgctttccgttcgcgcacaccgcgcatccggcgaacaaggcctccgcgcgcatccgg
atggcgacgccctacgcgggcgacgaccgcggcatgcacctgccgctgctgaagcgcacc
gaagtgaagatcgcattcgacggcggcgatccggaccgccccgtgatcgtcggcgcggtg
cccaactcgtcgcaccgcagcgtcgtcacgcgccgcaaccccgccgagcatcgcatcctc
accgagcacaaccagctctacatgaaggacggcagcggcgcggcgacgtggctgcacgcg
ccgaacaaccacatcggcatcggcgcggtcgggccgggcgacggcctcgcgctcctcacg
tccggcaacaagttcgacttctcgctcggcaacgcgtacagcttctcgggcgggctcaag
tgctcggtgtcgatgggcggcaacaccgacgtctacgtcggcgtgcgcaacagcctcgac
gtcagcgcgaacttcctgacgacgctgcagggcaacctgcgctggatgctgcccggcagc
cggagcttcgagatcaacgacagcgcatcgacactgctgcagacgctgcacaagcagtcc
gcgacgggcgcgatccggctgtccgccgggcaggacgcgtccgcgctgctgcaaaagcag
ctcgacaagctcaagggcacggtgcgcaagttcatgatcgtgtcgggcctcgcgaacgcc
gggtccgcggccgccgccgcggggctcatcaagggcggcggcaagctcgccaatctgccg
tgggcgggcttcggcatatccgccgcgcagttcgccggcgcgaccggcgtcagcacggcg
ctgatggcgacctcgcgcacgctgctcgcgaacgtcgcgaagctccaggaggcgttgccg
ctcgtcgccgatctgtcgctcggcaagcagggcatcgcgctcgccgcgaagaacctcacg
cacgcgacgcggatgtcgctcaccgtcgacggcgtctcgtggtcgacgcacgcgaagggg
cccggcgcggcgggcgccgcgatgagcgtcggcaagggccgctggggcgtcgaagcggcg
aagcacgcgcacgtccacgcgagcgacacgctgctgttcgcggtgccggccgacccgacg
acccagttcgacctgaaggacctgatcgggctgcgccgcgatctcgacgaatgcatgaag
gacatcgccgatctcgaagccgacatttcggaaaacgaagtgctgtcgaccgatcagaac
acgttcggcgtcagcgcgctcatccccacgccgccgtcgcccgccggcgcgctcgcggcg
gtcgcgatcaaggtgaagcaagcgaagctcgtcgagctgaaggccaagcagaagctcgtc
gcgctgaaggtcgacaacctgcagcagaagttcgcgaagcacgtgcagcacctgagcgcc
gtgcggatgagcgcttccgacgcgcagctcggcttcaagggcaaccggctcgtcgcgacg
gccgacggcgtcacgctctcgcatgcgcagggcaaggcgaagctcgacgtgcgcgaagcg
aagatcggcgtcacggcgggcaaatcgagcgtcgagctcgacgaaggcaagatcgcggcc
ggctgcggcagcgcatcgctgaagctcggcagcgacggcgcgatcgacgtaagcgcgacc
gacgtcaagctgaacggcaccaacgtcaagctgaacggcagcgcgtcgctgaagttcgac
ggccaactgatccagctcggctga

DBGET integrated database retrieval system