KEGG   Burkholderia pseudomallei MSHR305: BDL_4820Help
Entry
BDL_4820          CDS       T02756                                 

Definition
(GenBank) type VI secretion lipofamily protein
Organism
bpse  Burkholderia pseudomallei MSHR305
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: AGR69310
Position
1:1668145..1668942
Genome map
AA seq 265 aa AA seqDB search
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQA
RADVRWDYAPDALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTL
AAGGPAADFIQTTRYVVAPGQHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRI
DKRGWFSSTYRAAPRTLELKLRLGAQSITDAREAPLNLPPPGARAWTALDSGAKTLALPS
ADANDGGSGKRDKRGNAAARAPRKQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgacacattgccccgccggccgcgacgcgcgcgcgccggccgatgcagccc
ggccggccgtcatggccgtcgcgaacgtatcgcgcatgcgcggctcgcacatgcgctgcc
gtgctcgtcgcgctcgccgccctcgccggctgtgcggcccgcgtcaccgaagagcaggcg
cgcgccgacgtgcgatgggactacgcgcccgacgcgctgcgcatcgatatcgacgcgtcg
gcgcggttgaacgaatacctgaacgcgccgcacacgctgttgctcgcggtgttccagagc
gcggacgcgaaggcgttccgccagctcgccgacgatccggaccggctgcgcatgacgctc
gcggcgggcggccccgccgcggacttcattcagacgacccgctacgtcgtcgcgcccggc
cagcatgtcgcgctgtcgatcgatcgcgcgcagcaggcgcgctacgtcggcatcgtcgcc
ggctactacgacgccgacggcccacgcgcggcgcgcctgttcgaggtgccgctgcgcatc
gacaagcgcggctggttctcctccacctatcgcgccgcgccgcgaacgctcgagctgaag
ctcaggctcggcgcgcagagcatcaccgacgcgcgcgaagcgccgctgaacctgccgccg
ccgggcgcgcgcgcatggacggcgctcgacagcggcgcgaaaaccctggcgctgccgagc
gccgacgcgaacgacggcggcagcggcaagcgcgacaaacgcggcaacgccgccgcccgt
gcgccgcgcaagcaatga

DBGET integrated database retrieval system