KEGG   Burkholderia pseudomallei MSHR305: BDL_4821
Entry
BDL_4821          CDS       T02756                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bpse  Burkholderia pseudomallei MSHR305
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_4821
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_4821
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AGR69084
Position
1:1668975..1670372
AA seq 465 aa
MDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVEIR
SARLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDA
LPDAPTRYATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVR
DGERLRLDDDFAPPCYALSGSRTLLERVRCIRDELAGRARQLQQYKNPREMQRAEFDASY
AAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVGELSVFSERFDMLGETPDARG
GLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEPDGPQQPAQRSAQLPPDVFAD
RHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPGPPPRLPRRG
DARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggacaacgtctattggcatcaggggatgctgctgcaaccgcaacattttcagttggcc
gaactgcaccagcagttccgcttcgagccgtggctcgcgtgcggcccgccgcatttctgg
ggcgtcggcgcgctgtcgctcgcgcaggccgcgatcgatcgccgcgtggtcgagatccgc
tcggcgcgcctgctgttcgccgaccgcagctacgtcgaatatccgggcaacgcggtcgtc
gccgcgcgcgcgttcgatcccgcgtggctcgacgaaggccgcgcgctcgtcgcgcacgtc
gcgctcaggcggctcgcgcgcggcgcgaacaacgtgacggtcgcggccgcgcccgacgcg
ttgcccgacgccccgacgcgctacgcgacgctgccgtccgccgaggaggtcgccgatctg
cattcggaccatccgggcgcgccggtgcgcacgctcaagcacgtgctgaagatcgtgttc
gagcacgagctcgacgcgctcgccgcgcacgaaacgatcccgatcgcgcggatcgtgcgc
gacggcgagcgcctgcggctcgacgacgatttcgcgccgccctgctacgcgctgtcgggc
tcgcgcacgctgctcgagcgcgtgcgctgcattcgcgacgagctcgcgggccgcgcgcgg
cagttgcagcagtacaagaatccgcgcgagatgcaacgcgccgaattcgacgcgagctat
gcggcgttcctgctcgcgctgcgctcgctgaaccgcttcggcccgctgctgttccatctc
gccgaatgcgacgggcagcatccatggacggtctacggcgtgctgcgccaactcgtcggc
gagctgagcgtgttctccgagcgcttcgacatgctcggcgagacgcccgatgcgcgcggc
ggcctgccgccgtacgaccaccgcgatctgggcggctgcttctcgcgcgcgcacgcgctg
atcggccacctgctcgacgaaatcgcggtgggcccggactgcgtcgcgacgttcgagccc
gacggcccgcagcagcccgcgcaacgctcggcgcaactgccgcccgacgtgttcgcggat
cgccaccagatctatctcgcgatccgcagcgcgcacgatccggacacgctcgcgcaacgc
ttcgcgctcggcggccggatcgcggcgaccgacgaaatgccgcagctcaccgcgctcgcg
ctgccgggcgtcgaactcacccgcctgcccggcccgccgccgcggctgccgcgccgcggc
gacgcgcgctacttccggatcgagcaggccggccgcccgtgggacgcgatccggcgtgac
ggccgcgtgtcgctgcgctgggccgacgcgccggacgacctgcacgcggaactcgtcgcg
gtgaggcacacgcaatga

DBGET integrated database retrieval system